SecReT6
Protein ID: 218703473
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0221
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]252650..253996 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7N886
KEGG IDeum:ECUMN_0221
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-140, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|218703473|ref|YP_002410992.1| hypothetical protein ECUMN_0221 [Escherichia coli UMN026]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLNRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRHQMQFTHRSQLHTLHPEAFYQDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATISDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPWHEGYVYFELEKGTPAWQ
DVIKAGALALHISGTFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_011751.1|:c253996-252650 hypothetical protein ECUMN_0221 [Escherichia coli UMN026]
ATGGCAACAATGAAAAACAAGGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCATTGCGAGTACCTGCTGAACCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGCTTTAC
GGAACTCTCCATCAATACCGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCTGTAATCAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCGGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACCCTCCCCCTGTGCCGTATCCTCAATAAAAATGCTACCGGCGCACTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGGCTGCTTGCCACCCGCGCCGCCGACCTGGCCGGGCGCATCGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCCATCAAATGCAGTTCACGCACCGTTCACA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCAAGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCACTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGCT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAGCGATCCCACACTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCAAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACTCTTACCGCTGC
GCCGCGTCAGTTGCCCTGGCATGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCAGCCTGGCAG
GACGTGATAAAAGCGGGCGCGCTGGCGCTGCATATCTCCGGCACCTTCCCCGATCTGAACCTTCAGCTCT
GGGCGATAAGGGGATAA