SecReT6
Protein ID: 218703474
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0222
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]253999..254523 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7N887
KEGG IDeum:ECUMN_0222
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|218703474|ref|YP_002410993.1| hypothetical protein ECUMN_0222 [Escherichia coli UMN026]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFQAADYDQIATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIEPVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_011751.1|:c254523-253999 hypothetical protein ECUMN_0222 [Escherichia coli UMN026]
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTTGTGTTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGACGGTGAAGCCGCGCCGGTGGATGTCCAG
TTGGTGTATCTGAGCGACGACTCCAAATTCCAGGCCGCCGATTACGATCAGATTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAGAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGACACCGTAAAAACACT
GCCGCCGATCAAGCTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGCCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA