SecReT6
Protein ID: 218703476
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0224
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]255817..256866 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7N889
KEGG IDeum:ECUMN_0224
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-89, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|218703476|ref|YP_002410995.1| hypothetical protein ECUMN_0224 [Escherichia coli UMN026]
MAGENGSARPYIATKPPLSADVRNCNFYVLMEALYRRYGAPGQDISLRTEPAQEIVRFSSDANIGFPGTD
LSVLSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRNGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>ref|NC_011751.1|:c256866-255817 hypothetical protein ECUMN_0224 [Escherichia coli UMN026]
ATGGCAGGAGAAAATGGGTCAGCACGCCCTTATATAGCGACAAAACCGCCGTTATCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGTATGGCGCTCCGGGCCAGGATATTTCCCT
GCGTACCGAGCCAGCCCAAGAGATCGTGCGTTTCAGCTCTGACGCCAATATCGGTTTTCCGGGTACGGAC
CTGAGTGTGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGTTTCCTGGGCTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAACGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTAGCACCACAGCAGGCTAAAGGGATGCGCCTTGGCGATCCTGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA