SecReT6
Protein ID: 218703477
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0225
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]256830..258689 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7N890
KEGG IDeum:ECUMN_0225
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-190, Aligned region: 11..619
Protein Sequence: 619 a.a.     [Download]
>gi|218703477|ref|YP_002410996.1| hypothetical protein ECUMN_0225 [Escherichia coli UMN026]
MCGVISVAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEF
PEFTHGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSALAAQKVLSDNHDKIVS
SVACHFTLARDIWLQPLRILDTHNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYL
WFCECLMDAELIAGEYRLPLPDLWLEAAGFENQDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAP
LPDDFPASAFTLRLHFNRPLPADIKLRRDSLRLHCTPAINLFTHYAEPVRPDGRIAEYPLRASHRHPDAY
DIFQISTVTSKVKVSGTESNPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHRGLEHSIAFVH
ADGSIPDSSRFNDDVITTSLICTNRMIPARLHIGDICVAVNKNPAVASFHNVTRPTQPLWPVTDGDMHWS
LISAMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTL
WIRPDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEAWEWQEKMGQHALI
 
Nucleotide Sequence: 1860 bp     [Download]
>ref|NC_011751.1|:c258689-256830 hypothetical protein ECUMN_0225 [Escherichia coli UMN026]
TTGTGTGGAGTGATCTCTGTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGC
TTGGCAAACTGCTGGCGCAGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGA
CGTGGAGCGTCTGATGGAAGCCTTTGCCTTTATGTCCGGTAGCCTGCGTCAGAAACTTGAGGACGAATTC
CCCGAATTCACCCATGGGCTAATCCGTATGCTGTGGGCAAACTATTTACGCCCAGTTCCGGCCATGACGG
TTATTGCCTATGAACCCAAAACCGATCAGTTAAAAGTCCCTGTTCAAGTCTGCCGTAATGAACTGATCAG
AAGCCGCTCAGAAAAGTCCGCCCTGGCTGCTCAGAAGGTGCTGTCTGACAATCATGATAAAATCGTTTCT
TCCGTAGCCTGTCATTTCACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGACACCCACA
ACGCCAGCAGCCTGAAAGAAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCAT
GCTTGACCTGAACAAAATAACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAACTTTATCTG
TGGTTTTGCGAATGCCTGATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGT
GGCTGGAGGCCGCCGGATTTGAAAACCAGGACGCACTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTA
TCGGGTACTCCAGGAGTATTTCTGCTATCCCGAAGCCTTCTTTTTTTTCCATCTGCGCGATGTTGCGCCA
CTACCGGACGATTTCCCGGCCAGCGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACA
TCAAGCTACGCCGGGACTCACTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGA
ACCCGTCAGGCCTGATGGGCGGATAGCGGAATACCCGCTGCGCGCCAGCCACCGGCATCCCGACGCTTAT
GACATTTTTCAGATAAGCACAGTCACCAGCAAAGTCAAAGTTTCAGGTACTGAATCCAACCCTGGCAGCC
AGGCGCGTGTCTGGCCCGAATTTGAAAGTTTCCAGCACCAGATGGAGTACAGCCGCCAGCGGGAAGTCGT
CTACTGGCATCACCGGACTAAAACATCCCTGTTTCACCGCGGGCTTGAACATAGTATCGCCTTTGTCCAT
GCGGACGGCAGCATTCCGGACAGCTCACGGTTTAATGATGATGTGATCACCACGTCATTAATCTGTACCA
ACCGTATGATCCCTGCTCGGCTGCATATCGGCGATATCTGCGTGGCCGTCAACAAAAACCCGGCGGTGGC
CTCATTTCATAATGTCACACGCCCGACGCAGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCG
CTGATTTCCGCGATGAACCTGAACTACCTATCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGA
CCTTCGACCTGCCAGGCGCTCACCATCCGCAGCGGGCCAGACTGTCGCGCCAGAAACTGGATGCCATAGA
AAAACTCGAAACCAAACCTGTTGACAGGTTGTTTAAAGGCGTGCCGGTTCGCGGGCTGGCGACCACGCTG
TGGATACGTCCCGATCCATTTATCTGCGAAGGTGAAATTTATCTTCTTGGTACAGTGCTCTCGCACTTTT
TTGCTCTCTACGCCAGCATCAATTCGTACCACTGTCTGAAAATCATCAACACGGAAAGTCAGGAGGCCTG
GGAATGGCAGGAGAAAATGGGTCAGCACGCCCTTATATAG