SecReT6
Protein ID: 218703478
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0226
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]258677..259102 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7N891
KEGG IDeum:ECUMN_0226
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-21, Aligned region: 29..123
Protein Sequence: 141 a.a.     [Download]
>gi|218703478|ref|YP_002410997.1| hypothetical protein ECUMN_0226 [Escherichia coli UMN026]
MQRRDSGPTSSLFERIREAANPPSYQNTKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATVDVSETRGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>ref|NC_011751.1|:c259102-258677 hypothetical protein ECUMN_0226 [Escherichia coli UMN026]
ATGCAAAGACGGGATTCAGGGCCAACCAGCAGTCTTTTTGAACGTATTCGTGAGGCGGCCAACCCGCCTT
CATACCAGAATACAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGCTCACCAGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCGGCACCGGATGAATACGCCCCTGTGGAACTACGTTTTCATATTGTGGCTACGGT
CGATGTCAGCGAAACCAGGGGAGTGTTTGAATTTGACATTTTGCTGGACAATCATCAACGCTATTGTGTG
GAGTGA