SecReT6
Protein ID: 218703479
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0227
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]259107..260591 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7N892
KEGG IDeum:ECUMN_0227
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-182, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|218703479|ref|YP_002410998.1| hypothetical protein ECUMN_0227 [Escherichia coli UMN026]
MSVKEDIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPARTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKKFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>ref|NC_011751.1|:c260591-259107 hypothetical protein ECUMN_0227 [Escherichia coli UMN026]
ATGTCAGTAAAGGAAGATATTGCTCCCGTCAGCGCGTCGCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAGGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGTTGCTGAAATATATCAGCCAGGTCAGTGCGATGGC
GCACAGCCCGTTCCTCTCATCAGTATCATCCGAATTTTTCGGTCTGGACTCATGGACAGAGTTACCAGGG
ATCAAAGAACCAGGAGCAATCTTTGAAGGCCCGGCCTATTCCCGCTGGCGTGCCTTGCGTGAATCTGAAG
ATTCACGCTACCTGGGACTGACTGCCCCCCGGTTCCTGCTGCGTCACCCTTACTCGCCAGATGAGAACCC
AGCCAGGACCTTCCGTTACCATGAAGACGTCAGCCAGAGTCACGAGTCTTATTTGTGGGGGAACACCTCG
TTTTTACTAGCTGCGAACCTGGCTGAAAGTTTTGCTAAATATCGCTGGTGTCCCAATATCATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAAGGCTTTATCACACTGACC
ATGCGTAAAGGATCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAAAATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACTCAGCTGCCATACTTATTTGTAAT
CAGTAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGCAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTGGCCGACCAGGAGAATCCGCCTGCCGAAGTCC
GCAGCCACCGACCATTACGTCAGGCGAAGATCGAGGTACTTGATGTGGATGGTGAGCCAGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGTCTGGTCGGACGA
CTGGATAAGGAATAA