SecReT6
Protein ID: 218703480
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0228
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]260614..261117 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7N893
KEGG IDeum:ECUMN_0228
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|218703480|ref|YP_002410999.1| hypothetical protein ECUMN_0228 [Escherichia coli UMN026]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDSREQLIQELGIAAQK
 
Nucleotide Sequence: 504 bp     [Download]
>ref|NC_011751.1|:c261117-260614 hypothetical protein ECUMN_0228 [Escherichia coli UMN026]
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGACGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCGGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCTCTGGTCGCACTTAAGTCTCCACTAGGCAATATTCCGGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACAGCCGCGAGCAGCTGATCCAAGAACTGGGTATCG
CCGCTCAGAAATAA