SecReT6
Protein ID: 218703482
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0230
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]262559..264517 [+]
Productputative VgrG/E protein
NoteTssI
UniProt IDB7N895
KEGG IDeum:ECUMN_0230
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-62, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 8.90E-27, Aligned region: 367..459
Protein Sequence: 652 a.a.     [Download]
>gi|218703482|ref|YP_002411001.1| putative VgrG/E protein [Escherichia coli UMN026]
MSLKGLRFTLEIDGQEPDTFAVVHFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATLTIWQGVIPLR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGELPFNPDTSAGAETEC
VSMFRYEAYVRPSSVQSQDYTFKVPDWPGMYEQQGENLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMES
LRSDAEKATGQSNSPKLWPGTRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVQFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRIGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATD
KEEIYLHAQKNMQVVVLNSKDKRVNYDRTVSIGHDESLVVANDRKVTVEGKQDHKTTKDHVSLTEGNQGL
EVKGDLAQKISGALGISVQGDIVLQSDSKISLRVGGSFVVIHSGGVDIKGAKINLNGGGSPGDVILPMRP
VILKAAAGSGTMFVAHCPKEDK
 
Nucleotide Sequence: 1959 bp     [Download]
>ref|NC_011751.1|:262559-264517 putative VgrG/E protein [Escherichia coli UMN026]
ATGTCCTTAAAAGGTCTGCGCTTTACGCTGGAGATTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGC
ATTTCAGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTTGCCAGCGACTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAAGGCGACGCTGACCATCTGGCAGGGCGTCATCCCGCTGCGT
TATGTCACCGGCGTGGTGGCGGGTTTTGGCATGCAGGAGAACAATGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCAGAACTTCCGTATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACGTTACTGAACGAGAACGGCGTCACGGAGTGGACACCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTCCAGTACGGGGAAAGCGACCTGGCGTTTCTGGCGCGGTTGTGGGCGGAGG
AGGGAATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGAGAGCTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACAGAGTGT
GTCAGTATGTTCCGTTATGAGGCGTATGTCCGCCCGTCGTCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAACCTGAACGGACAGCTGGAGCAGTATGAGAT
ATTTGATTATCCGGGAAGGTTCAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCAGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCACCGAAGCTGTGGCCGGGAACGCGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGTATTCTGTCAGGGGA
CCAGCCGCAGGCGCTGCACGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGTCCTGCGGGAGAGGAAATCTTCTGCGACGAACACGGACGTGTGCGAGTGCAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCATGCTGGGTGAGGGTGTCGCAGGCGTGGGCGGGGCCGGGATTT
GGTAACCTGGCGATACCGCGCATCGGCCAGGAAGTGATTGTAGACTTCCTGAACGGCGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGTCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGCTTTAATGAACTGCGGTTCGAGGACGCGACGGAC
AAGGAAGAAATTTACCTGCACGCACAGAAAAATATGCAAGTCGTTGTGCTGAACAGCAAGGATAAGCGGG
TCAACTATGACCGGACGGTCAGCATCGGGCATGATGAATCCCTGGTGGTGGCAAATGACCGGAAAGTGAC
GGTTGAAGGTAAACAGGACCATAAAACCACCAAAGACCATGTCAGCCTGACAGAGGGCAATCAGGGGCTG
GAGGTGAAAGGCGATCTGGCACAGAAAATAAGCGGCGCGCTGGGTATCAGCGTACAGGGCGATATTGTTT
TACAGAGCGACAGCAAAATCAGTCTGCGGGTGGGCGGTTCATTTGTGGTGATCCATTCCGGCGGCGTGGA
TATTAAGGGCGCGAAAATCAATCTTAACGGCGGAGGCAGTCCGGGAGACGTGATCCTGCCGATGCGCCCG
GTGATCCTGAAAGCCGCAGCCGGAAGCGGGACAATGTTTGTGGCGCACTGCCCGAAGGAGGATAAGTGA