SecReT6
Protein ID: 218709310
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1319
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1422918..1424120 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7VNA6
KEGG IDvsp:VS_1319
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.20E-40, Aligned region: 53..249
SPOR [PF05036], Evalue: 2.00E-07, Aligned region: 318..374
Protein Sequence: 400 a.a.     [Download]
>gi|218709310|ref|YP_002416931.1| hypothetical protein VS_1319 [Vibrio splendidus LGP32]
MVMDYLDEETLIIDKAPKGSKDNETDQVASKLVAVHSTSAQEEFLRHFDKAENQLFNISSDLLTKTLKLS
TLSEPEDLAIFREQLIQGINDIKAQATELTYPIAVIDKLCFLYAVVIDEFIIYSEWGEKNGWENKTLLSE
LFGMRNGGELFFSVAEKAARQPHKLIDLLEIVYLFINIGFKGQYREGNADQLKAFTYQLEQTISQYRNTS
GVYCRIKVKLPEVRKPTRRKRYLITSLFFFCLIATSIGLTDFWYTNTHAQRARDFTYLPNFSQRYIVSGE
VKDIVFISEDKDLATLPRYASKVDAVEVLQSNKLTPSSSHWLVQLATFSSKQSADDFIDNLSPSVYQPIS
SPYEKYYRVILRANTKEEARSTKEWYVENDQINAIIVRTSAPDLNKEESN
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1424120-1422918 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGGTTATGGATTATTTAGATGAAGAAACTCTCATCATCGACAAAGCGCCAAAGGGCTCTAAGGATAACG
AAACTGATCAGGTAGCCTCTAAATTGGTCGCTGTGCATTCTACCAGCGCCCAAGAAGAGTTTTTGCGACA
CTTTGATAAGGCAGAGAATCAACTATTCAATATCAGTAGCGATTTACTAACCAAAACACTCAAGCTCTCA
ACCTTATCTGAACCTGAAGATTTAGCGATTTTTAGAGAACAGTTGATACAGGGTATAAACGACATAAAAG
CTCAAGCAACCGAGCTTACTTACCCTATTGCTGTTATCGATAAACTCTGCTTTTTGTATGCAGTGGTCAT
TGATGAATTCATCATCTACTCCGAGTGGGGAGAAAAAAACGGTTGGGAAAACAAAACGCTGCTTAGCGAG
CTCTTCGGCATGCGAAATGGTGGTGAGTTGTTTTTCTCTGTTGCAGAGAAAGCAGCACGACAGCCTCACA
AACTGATTGACCTTCTAGAGATAGTTTACCTCTTCATAAATATTGGATTCAAAGGCCAATATCGTGAAGG
TAATGCTGACCAATTGAAAGCATTCACCTATCAGTTAGAGCAAACCATCAGCCAATATCGCAATACTAGC
GGCGTTTACTGCCGCATCAAAGTGAAGCTCCCAGAAGTAAGGAAGCCAACAAGGCGTAAACGTTACTTAA
TCACTAGCCTTTTCTTCTTTTGTTTAATCGCAACGAGCATTGGCTTAACGGATTTCTGGTATACCAACAC
CCACGCTCAACGAGCTCGTGACTTCACGTATTTGCCTAATTTCAGTCAGCGTTACATCGTCTCCGGCGAA
GTAAAAGATATTGTCTTTATAAGCGAAGATAAAGACTTAGCGACTCTTCCTCGTTACGCAAGTAAAGTTG
ATGCTGTAGAAGTATTGCAAAGCAACAAGTTAACACCAAGTTCATCACATTGGTTGGTGCAACTTGCGAC
TTTCTCTAGCAAGCAAAGCGCTGACGATTTTATTGATAACCTGTCACCGTCAGTTTATCAGCCTATTTCT
TCTCCTTATGAAAAATATTACCGAGTGATATTAAGAGCAAACACAAAAGAAGAAGCAAGAAGTACCAAAG
AATGGTACGTAGAAAACGACCAAATAAACGCCATTATTGTTCGTACTTCTGCGCCTGACTTAAACAAGGA
AGAATCAAACTGA