SecReT6
Protein ID: 218709311
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1320
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1424120..1425493 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7VNA7
KEGG IDvsp:VS_1320
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.90E-118, Aligned region: 33..457
Protein Sequence: 457 a.a.     [Download]
>gi|218709311|ref|YP_002416932.1| hypothetical protein VS_1320 [Vibrio splendidus LGP32]
MHKPIYKNNRKGHYVDAFKKVVWQEGMFIAPQHFQQQDRYVQNYIRQNIETLAGFSPFYGITELVLNHDL
LKIGKLSIPSCSGVFPDGTQFNLKQEIVVDIPQGTIETIVYLALPISLQGNKDYCEDGQEQSRYITQSIN
VFDTSTSENSTVEVDVAQLNIGLKFAGEDTSGFTLIPVAKILEISDSDEVIYDRSFIPACLHYGASTLLV
ERVKEIHALVSNRAQNLLKRLEAGQDQKSPQSMMQDFLWLQTLSSWLPWFELTISNTKYPTHELYSKLKQ
FEAQVMALTPAIPDACPPLKYDKLYDNFNPLFSSLRNLLTLVQQDSVIEFKWDISLFEKRRLLRTLIKDP
SSIYNRRFVLSVKSDISSTELNELFPISAKLSSNNKIVELVRSSLSGISLKPLPIAPSELKPMQGVAYFE
VDTKDRNWLDMLDTRDAIALHVDARIPTLEVVLYALR
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1425493-1424120 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGCACAAGCCAATATATAAAAATAATAGAAAAGGACATTACGTGGACGCTTTCAAAAAAGTAGTGTGGC
AAGAAGGAATGTTTATAGCACCTCAGCACTTTCAGCAACAAGATCGCTATGTGCAGAACTACATTCGTCA
GAATATAGAGACATTAGCTGGTTTCTCTCCTTTTTATGGCATCACCGAATTAGTACTTAATCACGATCTA
TTGAAGATTGGTAAACTGTCTATACCGAGCTGCTCCGGTGTATTTCCCGATGGAACTCAGTTCAACCTTA
AGCAAGAAATCGTTGTCGATATACCTCAAGGCACCATAGAAACCATCGTTTACCTCGCATTACCGATTTC
TTTACAAGGTAACAAAGATTATTGTGAAGATGGGCAGGAACAAAGTCGCTATATCACCCAATCAATCAAT
GTATTTGACACATCAACATCAGAAAACTCTACCGTTGAAGTCGATGTCGCACAGCTAAATATTGGGCTAA
AATTCGCCGGTGAAGACACATCTGGTTTTACTCTGATTCCTGTTGCTAAGATATTAGAAATCAGTGATTC
AGATGAAGTGATCTATGACAGATCTTTTATTCCCGCATGTCTACATTACGGAGCTTCTACTCTGCTTGTC
GAGCGAGTTAAAGAGATTCACGCACTCGTCAGTAACCGAGCTCAAAACCTTCTGAAACGTCTTGAAGCAG
GACAAGATCAAAAAAGTCCTCAATCTATGATGCAAGACTTTTTATGGCTTCAAACTCTGAGCTCATGGTT
ACCGTGGTTCGAATTAACCATCAGCAACACCAAATACCCGACTCACGAATTATATTCTAAATTGAAGCAG
TTTGAGGCTCAGGTCATGGCACTAACACCTGCTATTCCTGATGCATGTCCGCCCTTAAAGTATGACAAAT
TATACGATAACTTTAATCCGCTGTTTTCTAGTCTTAGAAACTTGCTAACATTGGTTCAACAAGACTCTGT
TATTGAATTCAAATGGGATATATCACTGTTTGAAAAGCGTAGGTTACTGCGTACGTTGATCAAAGATCCT
AGTAGCATCTATAACCGACGTTTCGTTCTAAGCGTTAAATCCGATATCAGTAGCACAGAGCTCAATGAGC
TATTTCCTATTTCCGCGAAGCTAAGCAGTAATAATAAAATTGTCGAATTAGTAAGAAGCTCTCTGTCGGG
TATCTCTTTGAAACCCTTACCAATTGCGCCAAGTGAACTCAAGCCAATGCAAGGTGTGGCCTATTTTGAA
GTCGATACCAAAGATAGAAATTGGTTGGATATGCTCGACACTCGTGATGCCATCGCGTTGCATGTCGATG
CTCGTATACCAACCCTTGAAGTCGTTTTATATGCGTTGAGATAA