SecReT6
Protein ID: 218709312
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1321
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1425502..1425981 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7VNA8
KEGG IDvsp:VS_1321
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-31, Aligned region: 10..145
DUF3988 [PF13149], Evalue: 0.003, Aligned region: 11..35
DUF3988 [PF13149], Evalue: 0.003, Aligned region: 103..153
Protein Sequence: 159 a.a.     [Download]
>gi|218709312|ref|YP_002416933.1| hypothetical protein VS_1321 [Vibrio splendidus LGP32]
MKRLMLLSLCLMITACSSSDPAPVVTQYSLTVKADTTVNQYNDAQANPVVVRLYQLTDQQLFKQLPFIDL
YNNDLQLLAANLVSKQVLPIVLPNSEQQLTLDINKNTQYIAALIEFADYQNSTAKTVLMMPGDPEQTLEL
TITGKKAELASIQPDSSWW
 
Nucleotide Sequence: 480 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1425981-1425502 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGAAACGTTTAATGCTATTGTCTCTTTGTTTAATGATAACGGCGTGCTCATCGTCAGACCCCGCCCCTG
TTGTCACCCAATACTCACTGACAGTTAAAGCGGATACGACGGTCAACCAATACAATGATGCTCAAGCCAA
CCCTGTTGTCGTTAGGCTTTACCAACTCACAGATCAGCAACTGTTTAAACAATTGCCTTTTATTGATTTG
TACAATAATGACCTACAGTTGTTGGCTGCAAACTTAGTTTCAAAACAAGTATTGCCTATTGTGCTGCCCA
ACTCAGAGCAACAACTGACGTTAGATATTAACAAGAACACTCAATATATTGCCGCATTGATTGAATTCGC
CGATTACCAGAACAGTACAGCGAAAACTGTTTTAATGATGCCAGGAGATCCAGAGCAAACTTTAGAGTTA
ACGATTACTGGTAAGAAAGCGGAGTTAGCCTCAATACAGCCCGACTCCAGCTGGTGGTAA