SecReT6
Protein ID: 218709313
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1322
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1425978..1426928 [-]
Producthypothetical protein
NoteFha
UniProt IDB7VNA9
KEGG IDvsp:VS_1322
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-16, Aligned region: 29..95
Protein Sequence: 316 a.a.     [Download]
>gi|218709313|ref|YP_002416934.1| hypothetical protein VS_1322 [Vibrio splendidus LGP32]
MSISVHMISIPAEEVVTSRVVYLPENGGSLGRSPSCDIALPDQTKWVSRTHCQIYPTERGYAIKDVSNNG
ATLNDKSLIREKEYILSDGDIIKLGHYTLLVSLLSAPKVDATNNTNQDDLFIEPFNLKLDDNDTDFLDTT
PEVTIVKKASNFSSTNVLSDDPFSSDPFEDLDSDKVVPNIEVDEVVHNRGGSLPSAELEYFPVNAENNTR
IEESIDKLITLTEKNQQYLQNPQLQQKALFEALEQTVDQFLNEFAPKQLENQFSEYVSDGIFSNKDKKYW
KIYRKHFQHRQDNGDFRRQFKALFMENMQKQSERQE
 
Nucleotide Sequence: 951 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1426928-1425978 Vibrio splendidus LGP32 chromosome 1, complete sequence
TTGTCTATCAGTGTCCACATGATTTCTATACCTGCTGAAGAGGTCGTTACCTCTAGAGTCGTTTACCTGC
CTGAAAATGGCGGAAGCTTAGGTCGTTCGCCATCATGTGATATTGCGCTACCTGACCAAACCAAATGGGT
CTCAAGAACTCACTGCCAGATCTACCCCACTGAACGCGGGTACGCCATCAAAGACGTTAGTAACAATGGT
GCTACGTTAAACGATAAATCATTGATAAGAGAGAAAGAATACATACTTTCCGATGGCGATATTATAAAAT
TAGGTCACTACACACTGTTAGTTAGCCTGTTAAGCGCACCTAAAGTGGATGCTACGAATAACACCAATCA
GGATGATCTTTTTATAGAACCTTTCAACTTAAAGCTTGACGACAATGACACAGACTTTTTGGATACTACG
CCTGAAGTGACGATAGTTAAGAAAGCCTCAAACTTTTCTTCAACGAATGTTCTGAGTGACGACCCGTTCT
CGTCAGACCCCTTTGAAGATTTAGATAGCGATAAAGTCGTTCCCAACATTGAAGTAGACGAAGTCGTTCA
CAACAGAGGAGGCTCCCTGCCCTCTGCTGAGTTGGAATATTTTCCTGTCAATGCCGAGAACAACACACGA
ATTGAAGAGTCGATAGACAAGCTCATCACACTGACGGAAAAAAATCAACAATACTTACAGAACCCACAGC
TACAACAAAAAGCTCTTTTTGAGGCATTGGAACAAACGGTAGACCAGTTTCTAAACGAATTTGCACCAAA
GCAACTTGAAAACCAGTTTAGCGAATACGTGAGTGACGGCATTTTTTCCAACAAGGATAAAAAATATTGG
AAGATCTATCGAAAGCACTTCCAACACCGTCAAGACAATGGGGACTTCAGACGTCAGTTCAAAGCATTAT
TTATGGAAAATATGCAAAAGCAAAGTGAGAGGCAAGAATGA