SecReT6
Protein ID: 218709317
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1326
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1431277..1433889 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDB7VNB3
KEGG IDvsp:VS_1326
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-41, Aligned region: 219..240
AAA_2 [PF07724], Evalue: 3.20E-41, Aligned region: 424..494
AAA_2 [PF07724], Evalue: 3.20E-41, Aligned region: 600..767
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 219..352
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 606..727
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 219..245
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 309..349
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 555..591
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 605..726
AAA_5 [PF07728], Evalue: 2.40E-14, Aligned region: 790..825
ClpB_D2-small [PF10431], Evalue: 9.60E-13, Aligned region: 773..846
AAA_22 [PF13401], Evalue: 2.60E-10, Aligned region: 219..304
AAA_22 [PF13401], Evalue: 2.60E-10, Aligned region: 325..410
AAA_22 [PF13401], Evalue: 2.60E-10, Aligned region: 603..686
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 197..242
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 369..457
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 596..627
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 671..699
AAA_17 [PF13207], Evalue: 8.60E-07, Aligned region: 220..266
AAA_17 [PF13207], Evalue: 8.60E-07, Aligned region: 605..643
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 217..239
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 299..383
Zeta_toxin [PF06414], Evalue: 4.60E-06, Aligned region: 599..645
AAA_33 [PF13671], Evalue: 7.80E-06, Aligned region: 219..289
AAA_33 [PF13671], Evalue: 7.80E-06, Aligned region: 464..501
AAA_33 [PF13671], Evalue: 7.80E-06, Aligned region: 604..626
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 213..240
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 605..626
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 216..241
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 604..627
Mg_chelatase [PF01078], Evalue: 4.20E-05, Aligned region: 202..258
Mg_chelatase [PF01078], Evalue: 4.20E-05, Aligned region: 605..626
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 213..234
Sigma54_activat [PF00158], Evalue: 0.00011, Aligned region: 605..724
RNA_helicase [PF00910], Evalue: 0.00014, Aligned region: 220..240
RNA_helicase [PF00910], Evalue: 0.00014, Aligned region: 458..510
RNA_helicase [PF00910], Evalue: 0.00014, Aligned region: 606..630
RNA_helicase [PF00910], Evalue: 0.00014, Aligned region: 703..723
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 219..258
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 267..299
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 603..640
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 761..787
AAA_14 [PF13173], Evalue: 0.00076, Aligned region: 220..337
AAA_14 [PF13173], Evalue: 0.00076, Aligned region: 604..701
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 219..244
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 275..313
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 463..494
AAA_25 [PF13481], Evalue: 0.00093, Aligned region: 603..628
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 221..241
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 454..530
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 608..636
NACHT [PF05729], Evalue: 0.0014, Aligned region: 219..246
NACHT [PF05729], Evalue: 0.0014, Aligned region: 606..630
AAA_10 [PF12846], Evalue: 0.0015, Aligned region: 219..239
AAA_10 [PF12846], Evalue: 0.0015, Aligned region: 285..308
AAA_10 [PF12846], Evalue: 0.0015, Aligned region: 430..453
AAA_10 [PF12846], Evalue: 0.0015, Aligned region: 605..796
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 221..235
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 435..502
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 603..723
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 219..236
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 572..626
RuvB_N [PF05496], Evalue: 0.002, Aligned region: 674..698
Torsin [PF06309], Evalue: 0.0021, Aligned region: 561..630
SRP54 [PF00448], Evalue: 0.0028, Aligned region: 219..242
SRP54 [PF00448], Evalue: 0.0028, Aligned region: 479..513
SRP54 [PF00448], Evalue: 0.0028, Aligned region: 604..628
AAA_11 [PF13086], Evalue: 0.0082, Aligned region: 48..76
AAA_11 [PF13086], Evalue: 0.0082, Aligned region: 204..337
AAA_11 [PF13086], Evalue: 0.0082, Aligned region: 602..742
Protein Sequence: 870 a.a.     [Download]
>gi|218709317|ref|YP_002416938.1| protein disaggregation chaperone [Vibrio splendidus LGP32]
MTQVTLTNLVGKLAPALKQALEASAGSAMNQGVGAIEVEHWILQLISQKDPMLMTLCESQKLSIDALVSE
LTKKISMLPKGNEGQPTLSHGLTELIKDAWMIASVNYGHGEIVSLHLIQALMQQNVLGVTTLQLESLSNV
SLESLQGLIKKTPIARNSSAPSANGAVDSTPAGNDALSKYTVNLTQQAIDGNIDPISGRNAEVRKAIDIL
CRKRQNNPIMVGEPGVGKTAVVEGLALRIAADEVPSALQGVQIHSLDLGLLQAGASVKGEFENRLKDVIN
EVKSSEVPIIVFIDEAHTLIGAGGAAGQNDAANLLKPALARGEFKTIAATTWAEYKKYFEKDPALTRRFQ
VVTIEEPNAEDAMQMLRGVAASLQAHHGAFIAESAIEAAVNLSIRYLPSRQLPDKAISLLDTASARIALT
QGAKPEVLETLEQTIRYQENEKSALEKEEALFSNSAELIKELTLSIEENQQTLAAYYTRWEKEIELVDQI
KVIQQEITEAQELNAVDSNKQQQLDGLRIELANVQGEEPLVYAMVDDNTIAQVIANWTGIPVGNMMSDEI
AKLLTLEDELNTRVIGQDVAKNELAKAIRISRAGLTDNRKPIGVFLMCGPSGVGKTETAMALAEQLYGGS
NDLTVINMTEFKEEHKISMLLGSPAGYVGFGEGGVLTEAIRRNPYSVLLLDEMEKAHPGVHDLFYQIFDK
GHIKDSEGRTVDFKNTIIIMTSNAADQAICDVCAQTTDRIDNDKLLESIRPDLQQYFKPAFLGRTTIVPY
YPLNDEELAKITEISLNRIKKKLAEQYKASFTWDTNFIQFVVDRNTDPTTGGRAVEQIINRSLMPRLAEE
CIGRLSRSEPITQVTVSATNNSADFDLSIK
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1433889-1431277 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGACACAAGTAACGCTCACTAACTTAGTAGGCAAGCTAGCACCTGCCCTAAAGCAGGCGCTCGAAGCAT
CTGCTGGTTCAGCAATGAACCAAGGTGTTGGAGCTATAGAGGTTGAACACTGGATTCTTCAACTTATCTC
CCAGAAAGACCCAATGCTCATGACATTGTGTGAATCTCAGAAACTTTCAATAGATGCCTTAGTCAGTGAA
TTGACAAAGAAAATCTCTATGCTCCCAAAAGGTAATGAAGGTCAACCGACGTTAAGCCACGGCTTAACGG
AATTAATCAAAGACGCTTGGATGATTGCTTCAGTTAACTACGGGCATGGAGAGATCGTCAGCCTACACCT
TATTCAAGCTCTAATGCAGCAAAATGTATTAGGTGTGACGACCTTACAACTTGAATCATTAAGCAATGTT
TCACTTGAGTCTCTGCAAGGTCTTATCAAGAAAACTCCTATTGCACGTAACTCTTCAGCACCTTCAGCTA
ATGGCGCTGTCGATAGTACCCCCGCGGGTAACGACGCTCTAAGCAAATACACGGTAAACCTTACTCAGCA
GGCTATTGATGGCAACATCGACCCAATTTCAGGCCGTAATGCAGAAGTAAGAAAAGCGATTGACATCTTG
TGTCGTAAGCGCCAAAACAACCCGATTATGGTCGGTGAACCAGGCGTAGGTAAAACTGCTGTTGTTGAAG
GATTAGCGTTAAGAATTGCAGCCGATGAAGTCCCTAGTGCTCTACAAGGCGTACAGATCCACTCTTTAGA
CCTTGGCTTGCTGCAAGCCGGCGCGAGCGTTAAAGGTGAGTTTGAAAACCGCTTAAAAGACGTCATCAAT
GAAGTAAAAAGCTCAGAAGTACCCATCATTGTATTTATCGATGAAGCTCACACCCTTATTGGTGCAGGCG
GCGCTGCTGGACAAAACGACGCGGCAAACCTTCTAAAACCAGCCCTGGCGCGTGGTGAGTTCAAAACCAT
CGCTGCGACAACATGGGCGGAATACAAAAAGTACTTCGAAAAAGATCCGGCTCTAACACGCCGATTCCAA
GTTGTGACCATTGAAGAGCCTAACGCAGAAGATGCGATGCAAATGCTTCGTGGTGTGGCTGCTTCATTGC
AAGCTCACCATGGCGCTTTTATTGCTGAATCCGCGATTGAAGCAGCGGTCAACTTATCGATCCGTTACCT
TCCAAGTCGCCAACTGCCAGACAAAGCCATTAGCCTACTTGATACTGCCAGTGCACGAATCGCACTGACA
CAAGGCGCGAAGCCAGAAGTATTGGAAACACTAGAGCAGACGATTCGTTATCAAGAAAACGAAAAATCAG
CATTAGAAAAAGAAGAGGCACTGTTCTCCAACAGCGCTGAGTTGATTAAAGAGCTCACACTATCGATAGA
AGAGAACCAACAAACGTTGGCTGCGTATTACACGCGTTGGGAAAAAGAGATTGAATTAGTAGACCAAATT
AAAGTGATTCAGCAAGAGATAACTGAAGCACAAGAGCTAAATGCGGTTGACTCCAACAAGCAGCAACAAC
TCGACGGCCTACGTATCGAGTTAGCAAACGTACAAGGTGAGGAGCCCCTCGTCTATGCCATGGTCGACGA
TAACACTATTGCTCAGGTGATTGCGAATTGGACTGGTATCCCGGTTGGTAACATGATGAGCGATGAAATC
GCTAAGCTGCTGACCTTGGAAGATGAACTTAATACTCGAGTAATAGGACAAGATGTCGCAAAGAACGAAC
TAGCAAAAGCAATTCGTATTTCCCGAGCGGGTTTAACGGATAATCGAAAACCGATTGGTGTGTTCCTAAT
GTGTGGTCCAAGTGGTGTCGGTAAAACTGAAACTGCCATGGCACTTGCGGAGCAACTGTACGGAGGAAGC
AACGATCTTACTGTTATTAACATGACCGAGTTTAAAGAGGAGCATAAAATTTCCATGCTACTCGGCTCAC
CAGCAGGTTACGTGGGCTTTGGCGAAGGTGGTGTATTGACGGAAGCGATTCGACGCAACCCTTATTCTGT
ATTGCTATTGGATGAGATGGAGAAGGCTCACCCTGGCGTACATGATCTGTTCTATCAAATCTTCGATAAA
GGTCATATCAAAGACAGCGAAGGTCGAACCGTCGATTTCAAGAACACCATCATTATTATGACGTCGAACG
CTGCCGACCAAGCTATCTGTGACGTGTGTGCTCAGACTACCGATCGCATCGATAATGACAAGCTACTCGA
ATCAATACGTCCGGATCTGCAACAATACTTTAAACCTGCATTTTTAGGCCGAACTACCATTGTTCCCTAC
TACCCACTTAACGATGAAGAATTAGCGAAAATCACAGAAATATCGCTAAATCGAATCAAAAAGAAACTTG
CAGAGCAATATAAGGCATCATTCACTTGGGATACGAATTTCATTCAGTTCGTGGTCGACCGTAATACCGA
TCCAACCACTGGCGGTCGCGCTGTAGAACAAATTATTAACCGTTCACTGATGCCAAGATTAGCCGAAGAA
TGTATCGGGCGATTAAGCCGCAGCGAACCCATTACTCAAGTAACAGTTAGTGCAACGAACAACAGTGCTG
ACTTCGATTTATCTATTAAGTAG