SecReT6
Protein ID: 218709318
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1327
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1433936..1434868 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7VNB4
KEGG IDvsp:VS_1327
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-37, Aligned region: 10..293
Protein Sequence: 310 a.a.     [Download]
>gi|218709318|ref|YP_002416939.1| hypothetical protein VS_1327 [Vibrio splendidus LGP32]
MKHFIEDLTTQPEKYDFSQAMRLLERLQSHSSTQVQIQLKSEAMPTGNPQEIQYFSLKGNKAKLRLAKEA
LSGVKGVIPNYIYEELLNAIHNDDHSLQDFLDVFNQRHFEITYRTNVQRWLLVENEQNSKKAALLNHFSA
LGKEHKEYLQYSLLLSQQSRSLTTLKKILNDFFPYSIDVECKAFERRLLPTDSLTRLGTNRDFNSRLGQG
FLVGRTCLVNFNNLSIFVTPKSRSEFLEIQQDDQLAKSMWSLTQHYLKDNTPVAIYLNVKRSYLTKPRLS
SNVSIAARLGEIDYLAPQHSPDKSVNILLL
 
Nucleotide Sequence: 933 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1434868-1433936 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGAAGCATTTCATCGAAGATCTAACGACTCAACCCGAAAAGTACGACTTCTCGCAAGCAATGAGACTAT
TGGAACGACTCCAGTCTCACAGCTCTACTCAGGTACAGATCCAATTGAAGTCTGAGGCAATGCCAACCGG
GAACCCTCAAGAAATTCAGTACTTTTCGCTAAAGGGAAACAAGGCAAAGCTGAGATTGGCAAAAGAAGCG
CTTTCTGGTGTAAAAGGGGTAATTCCCAATTATATTTATGAAGAGTTGTTAAACGCGATACACAACGACG
ATCATTCACTTCAAGACTTTCTGGATGTGTTTAATCAACGCCACTTTGAAATCACCTATCGAACTAATGT
GCAACGTTGGTTACTCGTTGAAAACGAGCAGAATTCCAAAAAAGCGGCGTTATTGAATCATTTTTCAGCA
CTTGGGAAAGAACACAAAGAATACCTGCAATACTCACTATTACTTAGCCAACAAAGCCGTAGCCTTACAA
CGCTAAAAAAGATACTCAATGATTTTTTTCCTTACTCAATCGATGTCGAATGTAAGGCATTTGAACGTCG
CCTATTGCCTACAGATTCATTGACACGACTAGGTACAAATCGGGATTTCAATAGCCGTTTAGGCCAAGGT
TTCTTAGTAGGAAGAACCTGCCTCGTTAATTTCAACAACTTGAGTATTTTTGTTACTCCAAAAAGCAGAA
GTGAATTCCTAGAAATTCAGCAAGATGACCAATTAGCGAAATCCATGTGGTCTTTGACTCAGCATTACTT
AAAAGACAACACGCCTGTTGCCATTTATCTGAACGTTAAGCGTTCATATTTAACCAAACCCCGTTTATCA
AGCAACGTTTCTATTGCAGCTCGCCTAGGGGAGATCGATTATCTTGCCCCTCAGCATAGTCCTGATAAAA
GTGTAAACATTTTGCTTTTATAG