SecReT6
Protein ID: 218709319
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1328
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1434915..1436666 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7VNB5
KEGG IDvsp:VS_1328
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-138, Aligned region: 6..582
Protein Sequence: 583 a.a.     [Download]
>gi|218709319|ref|YP_002416940.1| hypothetical protein VS_1328 [Vibrio splendidus LGP32]
MTEPIMRYFEQELAFVRRSLGQFGQEYPTHAENLNIHQGKIEDPSMARLLDGVALLNAKVEKKLSEQLPE
VIEGILSVLYPSYIQTVPSVAYLELHTEDGPIESSSLPKGSLFSSTNTKNECLFKTVDELNIAPFNLSNA
RALSAPFSFNRPSTANQSSAVVQISLSTGDPDVYFSHLELGDLDFFVKGFENNADSLVDLLLNNTLSISI
SDSECAQHSTVDNLQLKNRISDLEFKFLPEHGNQFTGYQLINEFFFFKEKRQFFRLKNFAEHANKFDESE
IVINLFMSSLPSEFIRLFNKDVFKLNVVPAINLFEQTGEPIPYDHRTLSVPVNADAHSDNNIEIIEIQNV
YEITPNGEVPLIPLFKEKYSHNQSYDYWQSKHDHFGEVSIAISLSDTTNTEFSKLLGTKLLCTNGKQACG
VIGTLECLESIDLPGDFSPIYPPSAPIKKEIDQNIHWEFISLLNTNFTSLVQSSNPVAELKHMLSLCSRD
QVSSTEIQMIHSITFNSQVSAIRVLGKNVFSPGTEIELTLDATSPYLAFADVLNRFFQQFCSFDRYIQLK
IRLYGRDGFIKTYPKIHGSQLCL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1436666-1434915 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGACTGAACCCATTATGCGTTACTTCGAGCAAGAACTGGCCTTTGTGCGCCGTTCGTTAGGTCAGTTCG
GTCAGGAATACCCTACTCATGCCGAAAACCTCAATATCCATCAAGGTAAGATCGAAGACCCTAGCATGGC
TCGCTTACTCGACGGTGTAGCACTATTGAACGCAAAGGTCGAAAAGAAACTATCTGAACAGTTGCCTGAA
GTTATCGAAGGTATTTTGAGTGTTCTCTACCCTTCTTATATTCAAACTGTTCCTAGTGTTGCTTATCTTG
AACTTCATACTGAAGACGGTCCTATTGAATCAAGCAGCTTGCCTAAAGGCTCACTTTTTTCAAGTACAAA
CACGAAAAACGAGTGCCTATTTAAGACCGTTGACGAACTCAATATAGCACCATTTAATTTAAGCAATGCC
AGAGCATTGAGTGCGCCGTTTAGTTTCAACAGACCTTCAACAGCTAACCAAAGCTCCGCGGTTGTTCAGA
TATCTCTGAGTACTGGTGATCCGGATGTTTATTTCAGCCATTTAGAATTAGGTGATCTCGATTTCTTCGT
CAAAGGCTTCGAAAATAATGCTGACTCTCTCGTCGATTTGCTTCTCAACAATACCTTGTCGATTTCCATT
TCCGATTCCGAGTGTGCCCAACACTCGACCGTTGATAACCTTCAACTAAAAAATCGAATTAGTGATCTCG
AGTTTAAGTTCTTGCCTGAACACGGAAATCAATTCACCGGTTATCAACTGATCAATGAATTCTTCTTTTT
CAAAGAGAAGCGACAGTTCTTTAGACTAAAAAACTTTGCTGAACACGCGAACAAATTTGACGAGTCTGAA
ATCGTGATTAATTTGTTTATGTCATCATTGCCATCGGAGTTCATTCGTCTATTTAATAAAGACGTATTCA
AGCTCAATGTCGTGCCTGCGATTAATTTATTTGAGCAAACTGGCGAACCGATCCCATATGACCACCGGAC
TCTATCCGTTCCAGTTAATGCCGACGCTCATAGTGACAACAATATAGAAATCATTGAAATTCAAAACGTC
TATGAAATCACTCCGAACGGAGAGGTCCCTTTAATTCCACTTTTTAAAGAAAAGTATTCACACAATCAAA
GTTACGACTACTGGCAAAGTAAACACGATCACTTTGGTGAAGTAAGCATAGCGATTTCGTTATCGGACAC
GACAAATACAGAATTTAGCAAGCTACTTGGTACCAAGTTACTGTGTACAAATGGGAAGCAAGCTTGTGGT
GTAATCGGCACTTTGGAATGCTTAGAGAGTATTGATTTACCCGGTGATTTCTCACCTATTTACCCGCCGT
CTGCGCCGATTAAAAAAGAAATCGACCAAAACATCCACTGGGAATTTATTAGCTTATTGAACACCAACTT
CACATCATTGGTGCAATCTAGCAACCCGGTAGCTGAACTCAAACATATGTTGAGTTTGTGCAGTCGCGAC
CAGGTATCAAGCACAGAAATTCAGATGATTCACTCAATTACATTCAATTCGCAAGTTTCTGCAATTCGTG
TGTTGGGTAAGAACGTGTTCTCGCCCGGAACCGAGATTGAACTTACGCTTGATGCCACCTCACCTTACCT
AGCATTTGCCGATGTGTTGAATCGCTTCTTCCAGCAGTTTTGCAGTTTTGATAGATACATTCAACTTAAG
ATTCGTCTCTATGGGCGAGATGGTTTCATAAAAACATACCCTAAGATTCACGGTAGCCAATTGTGCCTGT
AA