SecReT6
Protein ID: 218709320
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1329
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1436659..1437081 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7VNB6
KEGG IDvsp:VS_1329
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-13, Aligned region: 16..116
Protein Sequence: 140 a.a.     [Download]
>gi|218709320|ref|YP_002416941.1| hypothetical protein VS_1329 [Vibrio splendidus LGP32]
MSFWKTFISDAKPYQDAEIEDIKFHLTKLLEAEASLTEIDNRLVEVNRSNFKFGIEDVHLLSATLENTQI
TLRIEAWIKSFEPRLHDISVELEQRKEGDNSLSFNIIAKVKTNNGERDLIFDSRIALSDLTTSIEEDSYD
 
Nucleotide Sequence: 423 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1437081-1436659 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGAGTTTTTGGAAAACCTTTATCAGCGATGCAAAGCCCTATCAGGACGCCGAGATTGAAGATATTAAGT
TCCACCTAACCAAGCTCTTAGAGGCAGAGGCTTCATTAACAGAAATTGATAATAGGCTCGTTGAAGTAAA
CCGCTCGAACTTTAAATTTGGTATCGAAGATGTTCATTTGCTCAGTGCAACTTTAGAAAACACTCAGATC
ACTTTACGTATCGAGGCTTGGATAAAAAGCTTCGAGCCACGATTACACGACATATCTGTTGAGCTCGAGC
AGCGTAAAGAAGGTGACAATTCACTATCGTTCAACATCATAGCTAAAGTGAAGACCAATAATGGTGAACG
AGACCTAATCTTTGATTCAAGAATCGCACTAAGCGATTTAACTACATCTATAGAAGAAGATAGCTATGAC
TGA