SecReT6
Protein ID: 218709321
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1330
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1437078..1438532 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7VNB7
KEGG IDvsp:VS_1330
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-121, Aligned region: 67..480
Protein Sequence: 484 a.a.     [Download]
>gi|218709321|ref|YP_002416942.1| hypothetical protein VS_1330 [Vibrio splendidus LGP32]
MLRFLVNRDLAGVIRPKFFMKLDTEWQNKFNQLDNTDNTFIKEALSLLSELDQHSLRSKSSLISLISTLI
SKIDTALSLQLDAIIQEPDFQKLERNWLSLQQLVSLPISYQRAHVKLLDMNWTEISSDVNQAYSTKSSDL
YNKIGNSELNTLGGHPFGCITFSHPISMDIDFDANYDDLFTVELLGKLGEATLCPMLFSPVPTFFGENGA
DWLSDITRINKILSGPDFKAWQDLRSKPSSRFIGMALPQVRLRDAYKNRRVGFVYNEQGKGSWGLANMVL
ATTIMREFHRVNWFGFLKSRWNDKLQGSVINLPASHYFDSHLQKPVADVSLFGQLSNFYAQSGFIPLTKS
PLTDKFYFNGNNSIWQCGQNDNDKVLTQIQTTLMSCRIAHYLKVQVREMVGSFNSANECELFLTNWIEKF
SSNVSFANEETLSKYPLSFAKVSVRESHSQAGSFACTLRIVPQYQFDYFSGEVVLTTDLNEVAS
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1438532-1437078 Vibrio splendidus LGP32 chromosome 1, complete sequence
TTGCTAAGATTCCTGGTTAATAGGGATTTGGCCGGAGTAATCCGGCCAAAATTTTTTATGAAGTTAGATA
CGGAATGGCAAAACAAATTTAACCAACTAGATAATACAGATAATACCTTTATAAAAGAGGCTTTATCTCT
ATTATCTGAGCTAGACCAACACTCTTTACGCTCTAAATCCTCATTGATTTCATTGATATCCACACTAATA
TCGAAGATTGATACTGCACTCAGTTTACAGCTCGATGCAATAATTCAAGAGCCTGATTTTCAAAAGTTAG
AACGCAACTGGTTAAGTCTTCAGCAACTTGTATCTTTGCCCATAAGCTACCAAAGAGCTCATGTAAAATT
ACTCGATATGAATTGGACTGAGATATCCAGCGATGTCAATCAAGCGTACTCAACAAAATCCAGCGATTTG
TATAACAAGATAGGTAATAGCGAGCTAAATACTTTAGGGGGTCACCCCTTTGGATGCATCACATTTAGCC
ACCCTATCTCGATGGACATCGATTTTGATGCCAATTATGACGACCTATTTACCGTAGAACTGTTAGGTAA
ATTAGGAGAAGCGACGCTTTGCCCGATGCTTTTCTCTCCAGTACCAACGTTTTTTGGTGAAAATGGTGCA
GACTGGCTCTCTGATATAACGCGAATCAATAAAATTCTATCCGGTCCTGATTTCAAAGCATGGCAAGACC
TACGCAGTAAACCAAGTTCACGCTTTATTGGCATGGCGCTACCTCAGGTTCGTCTTCGTGATGCATACAA
AAATCGACGAGTCGGCTTTGTTTATAATGAACAAGGCAAAGGCTCATGGGGCTTAGCCAATATGGTACTA
GCTACTACAATCATGCGGGAATTTCATCGTGTGAACTGGTTCGGTTTTCTGAAGTCTCGCTGGAATGACA
AGCTGCAAGGCTCTGTTATTAACCTCCCTGCGAGCCACTATTTTGACAGCCACCTGCAAAAGCCAGTAGC
GGATGTTAGCTTATTCGGGCAACTGTCTAATTTTTACGCGCAAAGTGGCTTTATTCCATTAACCAAAAGC
CCTTTAACCGATAAGTTTTACTTCAATGGCAATAACTCTATTTGGCAGTGTGGACAGAACGATAATGACA
AAGTGTTAACTCAGATTCAGACTACGCTAATGTCTTGCAGAATTGCCCATTATCTAAAAGTGCAAGTGCG
TGAGATGGTCGGCAGTTTCAACAGTGCCAACGAATGTGAGCTATTTTTAACAAACTGGATCGAAAAATTT
TCCAGCAATGTCTCATTTGCAAATGAAGAAACCTTGTCCAAATATCCATTGAGCTTTGCCAAAGTTAGTG
TCAGGGAATCTCATTCTCAAGCTGGCAGTTTTGCCTGCACTCTGCGTATCGTTCCTCAATACCAATTTGA
TTACTTTAGTGGCGAGGTTGTGCTGACTACCGATCTAAACGAGGTAGCATCATGA