SecReT6
Protein ID: 218709323
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1332
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1439991..1440494 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7VNB9
KEGG IDvsp:VS_1332
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-56, Aligned region: 7..160
Protein Sequence: 167 a.a.     [Download]
>gi|218709323|ref|YP_002416944.1| hypothetical protein VS_1332 [Vibrio tasmaniensis LGP32] [TssB]
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDYSGHKQDKEEVEDRTFYNVDKDNFDTVMK
RVGPELSLKVDNVLAGDDSQFEASLKFDSMKDFEPEAIIEQVEPLKKLVETRNQLKVLLSKADRSRDLEK
LLKEVLQSADTINALSDELGIKEEGAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1440494-1439991 Vibrio atlanticus chromosome 1, complete sequence [TssB]
GTGGCACTAAATTCCCAACATAAACGCGTAAGTAAGAACCGCGTAAGTATTACCTATGACGTTGAGACTA
ATGGCGCTGTAGAAACCAAAGAGCTCCCTTTTGTTGTTGGGGTTATTGGTGACTACTCAGGCCATAAGCA
AGACAAAGAAGAAGTAGAAGACCGTACTTTCTACAACGTTGATAAAGACAACTTCGATACTGTAATGAAG
CGTGTTGGCCCTGAGTTATCACTAAAAGTAGACAACGTACTTGCAGGTGATGACAGCCAGTTTGAAGCAA
GCCTTAAGTTTGACTCGATGAAAGATTTCGAACCTGAAGCAATTATCGAGCAAGTTGAACCGCTAAAAAA
ACTAGTTGAAACCCGTAACCAACTGAAAGTACTTCTTTCTAAAGCCGATCGTTCTCGTGACCTAGAAAAA
CTGCTTAAAGAAGTTCTACAAAGTGCAGACACGATTAATGCGCTTTCTGATGAGCTAGGTATAAAAGAAG
AAGGAGCTGAGTAA