SecReT6
Protein ID: 218709324
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1333
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1440514..1441035 [-]
Producthypothetical protein
NoteTssD
UniProt IDB7VNC0
KEGG IDvsp:VS_1333
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-22, Aligned region: 5..144
Protein Sequence: 173 a.a.     [Download]
>gi|218709324|ref|YP_002416945.1| hypothetical protein VS_1333 [Vibrio splendidus LGP32]
MASIFMRIEGTTPKGAATVEKIGGKDGFFALDSISWSAVRGVGIDVGNANNADQGMVALGEVNISRGCDG
ASPHLTTFLYAPGPEGRTVEIVMTKPNREGSGADPYLILTMKMARMSSYNMSGTDGSLPSESFSLTYTQI
SKAYYIEADGGKIEKGPEVGFDATTAKVTSTAK
 
Nucleotide Sequence: 522 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1441035-1440514 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGGCTTCTATTTTTATGAGAATTGAAGGTACGACACCAAAAGGTGCAGCAACGGTAGAAAAAATCGGGG
GCAAAGATGGTTTCTTCGCACTCGATAGTATTTCTTGGAGCGCTGTCCGTGGTGTTGGCATCGATGTAGG
TAACGCAAACAATGCTGACCAAGGCATGGTTGCTCTTGGCGAAGTTAACATTTCTCGTGGCTGTGATGGT
GCGTCGCCACATCTAACTACTTTCTTGTACGCTCCGGGTCCAGAAGGTCGCACTGTTGAAATCGTTATGA
CAAAACCAAACCGTGAAGGTTCTGGTGCAGATCCATACCTAATTCTAACGATGAAAATGGCTCGTATGTC
TAGCTACAATATGTCAGGTACAGACGGTTCACTTCCTAGCGAATCTTTCAGCCTAACCTACACTCAAATT
TCTAAGGCTTACTACATTGAAGCTGACGGCGGTAAGATCGAGAAAGGCCCTGAAGTTGGCTTCGACGCGA
CTACAGCTAAAGTCACTTCAACTGCTAAGTAA