SecReT6
Protein ID: 218709325
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1334
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1441070..1442566 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7VNC1
KEGG IDvsp:VS_1334
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-14, Aligned region: 76..137
Protein Sequence: 498 a.a.     [Download]
>gi|218709325|ref|YP_002416946.1| hypothetical protein VS_1334 [Vibrio splendidus LGP32]
MIEISNNFNRTCMTEIAHLLTPISDNDPSGSYLKLDRTAYRSLRNVYNSAQSSFRQLVETPDASSDPAIV
DANTENWAELRKISEETLTSQSKDLEILGWYITSQLFTSQPFHNLATAIPALNLFINQFWDTLNPMLPDA
KLKASDDAGKAKEITEFRAKSLLQLVGESLDSSSLYIPFQMLDFCSGVTFGDYLTAERKGNIAELKESAL
NAFDQSVAETLFHLASIYSDLEMAEKNLAEKCRAVSASVISFNFIKTNVRDLIKAIHFLVGEKFAPWPLD
DNFHVIQRSTETREQSDSIPSASEQTVAVKNEPISATGTGHNSEPVNQGNGSVVDNGQVQSSNGHPSQTQ
TQTIVQNVSSINGIVNRDHAFQEIRKIAEYFKETEPHSPIAFLLERSIRWGYMSFPELLQEMIGNEQSVI
AQINQMTGMDNLDKLDLSGKPVPVITSAPEFAPVSKPTIEEPTKVTPIPISPNSTADTNQASESTSNSSS
SSMQDFEW
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1442566-1441070 Vibrio splendidus LGP32 chromosome 1, complete sequence
GTGATCGAGATATCAAATAACTTTAACAGGACGTGTATGACAGAAATTGCTCATTTACTGACTCCAATCT
CGGATAATGACCCCTCCGGCTCTTACCTGAAATTGGATAGAACCGCATACCGCAGTTTAAGAAACGTTTA
CAATAGCGCTCAATCTTCATTTCGTCAGTTAGTTGAAACACCTGATGCATCTTCTGACCCAGCAATTGTG
GATGCAAATACTGAAAACTGGGCTGAGTTAAGAAAAATTTCTGAAGAGACACTCACCTCCCAGTCTAAAG
ATTTAGAAATATTAGGTTGGTACATTACTAGCCAGCTTTTTACTTCACAGCCATTTCATAACCTTGCTAC
AGCTATCCCAGCTTTAAACCTTTTCATCAACCAATTTTGGGATACGCTAAATCCAATGCTACCAGACGCT
AAATTAAAAGCTTCTGATGATGCAGGAAAAGCAAAGGAAATCACTGAGTTCAGAGCTAAATCTCTACTTC
AGCTAGTTGGTGAATCACTGGACTCCAGTTCTCTTTACATACCTTTTCAAATGCTTGATTTTTGTTCAGG
TGTAACTTTTGGGGATTACCTCACAGCCGAACGAAAAGGTAACATCGCTGAACTGAAAGAATCAGCCTTG
AACGCGTTTGATCAAAGCGTTGCAGAAACACTCTTCCATTTGGCCAGTATCTATAGTGATCTGGAAATGG
CAGAGAAAAACCTGGCTGAAAAGTGCCGAGCTGTTAGCGCCTCGGTGATCAGTTTCAACTTTATCAAAAC
CAACGTACGTGACCTGATTAAAGCGATTCATTTCCTAGTAGGAGAAAAATTCGCTCCTTGGCCTTTGGAC
GACAACTTCCACGTCATCCAAAGATCAACCGAAACGCGCGAACAAAGCGATTCAATACCTTCGGCATCGG
AACAGACGGTTGCCGTCAAAAATGAACCTATTTCAGCAACAGGAACAGGCCATAATTCAGAGCCAGTGAA
TCAAGGTAACGGGAGCGTGGTAGATAACGGTCAGGTTCAATCATCAAATGGCCACCCCTCTCAAACCCAA
ACTCAGACGATTGTTCAAAACGTGTCGAGTATTAACGGTATTGTTAATCGTGATCATGCGTTTCAGGAAA
TTAGAAAAATTGCTGAGTATTTTAAAGAGACTGAACCTCATAGCCCAATCGCCTTTTTATTGGAGCGTTC
AATTCGTTGGGGTTACATGAGTTTCCCAGAACTACTCCAAGAAATGATAGGTAATGAGCAAAGTGTGATC
GCTCAAATTAATCAAATGACCGGGATGGATAATCTAGACAAGTTGGACTTGTCAGGCAAGCCCGTCCCAG
TAATAACTTCAGCACCAGAGTTCGCTCCGGTGTCGAAACCGACTATTGAGGAACCAACTAAAGTAACGCC
AATTCCTATTAGTCCAAATAGCACAGCAGATACCAACCAAGCATCTGAATCTACTTCCAACTCATCATCA
AGCAGCATGCAAGATTTTGAGTGGTAA