SecReT6
Protein ID: 218709326
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1335
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1442749..1443048 [-]
Producthypothetical protein
NotePAAR
UniProt IDB7VNC2
KEGG IDvsp:VS_1335
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 8.60E-22, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 8.60E-22, Aligned region: 23..89
DUF4150 [PF13665], Evalue: 0.00053, Aligned region: 9..49
DUF4150 [PF13665], Evalue: 0.00053, Aligned region: 49..85
Protein Sequence: 99 a.a.     [Download]
>gi|218709326|ref|YP_002416947.1| hypothetical protein VS_1335 [Vibrio splendidus LGP32]
MTLAARLTDMHVCPMQTPALPPIPHVGGPIVGPGVPTVLIGNMPAATLGDMCVCVGPPDSIIKGSATVLI
MNKPAARMGDTTAHGGTIVLGMPTVMIGG
 
Nucleotide Sequence: 300 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1443048-1442749 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGACGTTAGCCGCAAGATTAACTGACATGCATGTTTGCCCGATGCAGACACCCGCACTTCCACCAATCC
CCCATGTCGGAGGCCCAATCGTTGGACCTGGTGTACCGACGGTTCTCATTGGCAATATGCCTGCAGCAAC
GCTTGGGGATATGTGTGTTTGTGTTGGCCCCCCAGATAGCATCATCAAAGGCAGTGCTACTGTACTTATC
ATGAATAAGCCTGCTGCGCGTATGGGAGATACAACCGCCCACGGGGGTACTATTGTCTTGGGTATGCCTA
CCGTAATGATTGGAGGATAA