SecReT6
Protein ID: 218709328
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1337
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1443693..1445192 [-]
Producthypothetical protein
NoteTssI
UniProt IDB7VNC4
KEGG IDvsp:VS_1337
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 5.40E-26, Aligned region: 203..295
Phage_GPD [PF05954], Evalue: 1.40E-11, Aligned region: 15..173
Phage_GPD [PF05954], Evalue: 1.40E-11, Aligned region: 406..452
DUF2345 [PF10106], Evalue: 0.00018, Aligned region: 362..418
DUF2345 [PF10106], Evalue: 0.00018, Aligned region: 447..476
DUF3540 [PF12059], Evalue: 0.0033, Aligned region: 352..469
Protein Sequence: 499 a.a.     [Download]
>gi|218709328|ref|YP_002416949.1| hypothetical protein VS_1337 [Vibrio splendidus LGP32]
MLKKGFITFSNVHIFQHSDSDHVMMLQDAQSPYKKSDIGKLDMIEVPSGNNPLLDKWMPQGQFHGASIEL
TSYDYSQTKLVSSKQKKSSHKIANNTKLTKQFYPNLGITGGMEDLASNLVKRRIEQLEQNYQTVEAEAQH
DSFELGKWFSLSSHLDKDQLGDYLVTELYTSYSTENHCQTRLTLLDTSTPNYPSLTDKAKIHGLQSAIVA
GNTAGEINQDEQGRVRIQFHWDTQTSGDKTSCYVRVAQMMAGNGYGAQFIPRVGQEVLVSFIDGDPDQPI
ITGSVYNSKNPPPYKEANSTKTGISTKLSGLANELYFDDKKDNELLYMHATKDFTKEIENNLTETIKGEL
IQKTTKQVNVSTEDNYTLNSDKAIAAKGKSISLEADDKIELKVGSSKITMSSSSISIEASNIDIKASSAL
NLEGMNVTSKATSANKISGVTTALEATSSNSIKGLSVAIKADTTLTAEGSLSAEFKSGLKGTFNGGVLGE
LKGAIVKVN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1445192-1443693 Vibrio splendidus LGP32 chromosome 1, complete sequence
TTGCTGAAGAAGGGGTTCATTACTTTTTCCAACGTTCATATTTTCCAACACAGCGACTCAGATCACGTGA
TGATGCTACAGGACGCTCAGAGCCCTTATAAAAAGTCAGATATCGGTAAACTGGACATGATTGAAGTCCC
TTCAGGCAACAATCCATTACTCGATAAATGGATGCCACAAGGTCAATTTCATGGCGCCAGCATCGAACTG
ACTAGTTATGATTACTCACAAACTAAGCTCGTGAGCAGTAAACAGAAAAAATCCAGCCATAAGATAGCTA
ACAACACCAAGTTAACGAAACAGTTTTACCCTAACCTTGGTATAACTGGTGGGATGGAAGACCTTGCCAG
TAACCTAGTGAAAAGACGCATTGAACAGCTCGAGCAAAATTATCAAACCGTAGAAGCCGAAGCGCAACAC
GATTCATTTGAATTGGGCAAGTGGTTTTCACTATCATCCCATTTAGACAAAGATCAACTCGGTGACTATT
TAGTCACAGAACTTTACACGAGTTATAGCACCGAAAACCATTGTCAAACACGTCTCACCCTTCTTGACAC
GTCGACTCCTAATTATCCTTCACTGACGGATAAGGCAAAAATACACGGACTACAAAGCGCCATCGTAGCC
GGCAATACCGCTGGTGAGATTAATCAAGATGAACAAGGTCGAGTTCGCATTCAATTTCATTGGGATACAC
AAACATCCGGAGACAAAACGAGTTGCTACGTGCGTGTTGCTCAGATGATGGCTGGCAATGGTTATGGTGC
TCAGTTTATTCCAAGAGTAGGACAAGAAGTACTGGTCAGTTTTATTGATGGTGACCCAGACCAACCGATT
ATCACAGGAAGCGTTTATAACAGTAAAAACCCACCACCTTACAAAGAAGCTAACTCAACGAAAACAGGCA
TTAGCACTAAGTTAAGCGGATTGGCTAACGAGCTCTATTTTGACGATAAGAAAGACAATGAGCTCTTGTA
CATGCATGCAACCAAAGACTTCACGAAAGAAATAGAGAACAACCTGACAGAGACCATTAAAGGTGAACTA
ATCCAGAAAACCACCAAACAAGTTAACGTCTCAACAGAAGATAATTACACCCTCAACTCAGACAAAGCTA
TCGCTGCCAAAGGTAAATCTATATCCCTAGAAGCGGATGACAAGATTGAGCTAAAAGTTGGGTCCAGCAA
AATCACTATGTCTTCATCTTCTATTAGTATTGAAGCAAGTAACATTGATATCAAAGCGAGTAGCGCACTC
AACCTTGAAGGCATGAACGTAACAAGTAAGGCGACATCCGCGAACAAGATATCAGGTGTAACAACCGCTC
TCGAAGCGACAAGCTCCAACAGTATTAAAGGACTCAGTGTCGCGATTAAAGCGGATACTACACTCACAGC
AGAGGGGTCTTTAAGTGCCGAGTTTAAATCAGGCCTAAAAGGTACTTTTAATGGCGGCGTACTTGGCGAA
TTAAAGGGCGCTATTGTAAAGGTGAATTAG