SecReT6
Protein ID: 218709329
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1338
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1445092..1445691 [-]
Producthypothetical protein
NoteTssI
UniProt IDB7VNC5
KEGG IDvsp:VS_1338
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-37, Aligned region: 31..187
Protein Sequence: 199 a.a.     [Download]
>gi|218709329|ref|YP_002416950.1| hypothetical protein VS_1338 [Vibrio splendidus LGP32]
MTDNFSPSASAIVAKDSKSNEHAVSDFAISEYLSKPFKIELTLISKNFSIDDQLGQKLSITRFINDTNNQ
AATRVFNGIVTQVQLLGMDSNLQYSSYRITLRPWFWLLIHTHSFRVYQNQSTKDIVSDVLTQAGFSGSFK
AGTMPSSKREYCVQYDESDFDFVTRLLAEEGVHYFFQRSYFPTQRLRSRDDATGRSEPL
 
Nucleotide Sequence: 600 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1445691-1445092 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGACGGATAATTTCTCCCCTTCTGCCAGTGCGATTGTGGCAAAAGATTCTAAAAGCAATGAGCATGCAG
TCAGCGATTTTGCTATTTCTGAGTACCTGTCGAAGCCTTTTAAAATCGAACTAACACTCATCTCAAAAAA
CTTTTCAATTGATGACCAGCTTGGTCAAAAGCTTTCGATTACACGCTTTATTAACGACACTAACAACCAA
GCAGCCACGCGTGTATTCAACGGCATTGTTACGCAAGTTCAGTTATTGGGCATGGACAGTAACCTGCAGT
ATTCTAGTTATCGCATCACTCTAAGGCCATGGTTTTGGTTATTGATACACACTCATTCTTTCCGTGTTTA
TCAAAACCAATCGACTAAAGATATCGTTTCAGATGTGTTAACCCAAGCAGGTTTCAGTGGCTCATTTAAG
GCTGGTACCATGCCCTCATCCAAACGAGAGTATTGCGTTCAATATGATGAAAGCGACTTTGATTTCGTAA
CTCGCCTGCTTGCTGAAGAAGGGGTTCATTACTTTTTCCAACGTTCATATTTTCCAACACAGCGACTCAG
ATCACGTGATGATGCTACAGGACGCTCAGAGCCCTTATAA