SecReT6
Protein ID: 218888819
SecReT6 ID324
T6SS typei3
Gene symbolppkA
Locus tagPLES_00751
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]86087..89185 [-]
Productserine/threonine protein kinase PpkA
NotePpkA
UniProt IDB7V0W0
KEGG IDpag:PLES_00751
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.40E-52, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 7.20E-35, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 2.30E-13, Aligned region: 616..791
APH [PF01636], Evalue: 2.10E-05, Aligned region: 12..104
APH [PF01636], Evalue: 2.10E-05, Aligned region: 115..150
APH [PF01636], Evalue: 2.10E-05, Aligned region: 214..264
Kinase-like [PF14531], Evalue: 0.0002, Aligned region: 119..212
VWA [PF00092], Evalue: 0.00053, Aligned region: 616..772
Protein Sequence: 1032 a.a.     [Download]
>gi|218888819|ref|YP_002437683.1| ppkA gene product [Pseudomonas aeruginosa LESB58]
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTLARLSHPNTVT
IHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPELGLVYVRQVAAALGYAHSQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKD
SLSTALAHLTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQG
SPRASNPPPAEPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGG
SRTPLIAAAAAAVLLAIGGGAWWLLSSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDGWLPASAVSDW
KQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLL
PIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYI
DRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATD
VSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYAL
HLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQS
LKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWL
SLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c89185-86087 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGACATAGAACTTCCGGGATTCGACATCGAACGCGAGCTGGGCGAAGGCGCCATGGCCACGGTCTACC
TGGCCACCCAGCGCTCGCTGCAGCGCAAGGTGGCGCTGAAGGTGATGGCCGCGGCGCTAGCCGCCGACCC
GAGCTTCGCCGAACGCTTCCTGCGCGAAGGTCGGACCCTGGCGCGGCTGTCGCACCCGAACACGGTGACC
ATCCACGACATCGGCAACGTCGGCAGTTGCTACTACATGGCCATGGAATACCTGCCCAACGGCACGCTCA
AGGAGCGCATCCAGCAGGGCCTCGATCCCGAGCTGGGCCTGGTCTACGTACGGCAGGTGGCCGCCGCGCT
CGGCTACGCGCACTCCCAGGGCCTGGTGCATCGAGACGTGAAGCCGGCCAATATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCGATCGAGGACAATACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACCCCCAGCTACATGAGCCCGGAGCAGGCCCGCGGGCAGGAGATCGACGGCCGCGC
CGACCTCTACGCGCTGGGCGTGGTGCTCTACGAGATCCTCACCGGCAAGCTGCCCTACAACGGCAAGGAT
TCGCTCTCCACCGCCCTGGCCCACCTCACCGAGCCGCTGCCGGAACTGCCGATCGAACAGGGCCGCTACC
AGGACATCCTGCGCCAGTTGCTGGCCAAGGACCCGGCCGAGCGCTTCCCAACCGCCGGCGCGCTGATCGC
CGCCCTCGACCGCCTGGCGCCGAGCGCCCTGGAAGCCACCCAGATCCGTCCGCTGGCGACGCCGCAGGGC
TCGCCGCGAGCGAGCAACCCGCCGCCGGCCGAACCCGCGCCCATGCCGCCCGCCGACCTCGGCGGCCTGC
AACCGGTATCGATCCAGTTGCCGCCGGTCACGCCCAGCGCCGGCGGCGCCACGCCGCCCCCGCCTCCGCC
ATCGCAAGCGGCGAAACCGCCATCGCCCCCGCCGCCTCCGCTGCCACCGGCGAAGCCGCGTGCCGGCGGC
AGCCGCACGCCGCTGATCGCCGCCGCCGCGGCCGCCGTGCTCCTGGCGATCGGCGGCGGCGCCTGGTGGC
TGCTGAGCTCGGGCGACGCGCCGAGCGCTGCCGATCCAGCGCCGCTGGGACAGACGCCGGCGGACAAGCC
GCAGCAGCAGACCCCGGTGGCCGATGCCGAACAGGACGGCGGCGAGCGTCCGCTGCTGATGCCAGGCAAG
AAGACCCTGTTCCAGCGCGTCCTGACCAAACCCGGCGCGGCCATCTCCGCCGAGGCTGGCGGCCCGCCCC
GGGCCGGCGCGGTGCCGGCCTTCTCGGTGCTCTACGTGTACGCCCGCAAGCAGGTCGGCGGCAGCCCCTG
GCTGCGCGTCGGCGCCTCCAGCAACGGAGAGGGCGACGGCTGGCTGCCGGCCAGCGCGGTGAGCGACTGG
AAGCAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGCCGCGCGCCGGTGATGTTCCTCAACAGCGCCG
AGCAGGTCGAGCGCCTGCTCGGCGATACCCGCGCAGCGCGCGACACCCTGACCCAGGCGGTGGATCACAA
GGGCGATCCGCAGGTGGTCGCGGTCGAGCCCAACGACCGGGCGATCCCCCAGGACCAGTTCTACCTGCTG
CCGATCTTCGACTCGAAGGAAAGCTTCGACGCCGACGGCCAGCCGGCGCAGTTGCTGGAGGTCGCCTCGA
TCGACCCCGGCGGCAGCGCCGCGGCACCCCAGGCGCCGGGCCAGGCCGGGCAGGGCGGCGCCAGCGGCGC
GGCGAGCGACACCTTCCGCACCGGCATCGTCCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATC
GACCGCGTGCGCGAGGTGATCGACGGCCTGCAGCGGCAGATCGGCGAGCGCGGCGACCTGGACAAGGTCA
GCTTCGGCCTGGTCGGTTTCCGCAACAACACCGACAAGACCCCCGGCCTGGAATACGTCAGCAAGACCCT
GGTGCCGCTGCAACCGGGCAACGACGCGCAGCGCTTCGCCGAGTTGAGCAGCCAGGTGCGCGCCACCGAC
GTCTCCAGCCACTCGTTCAACGAAGACGCCTTCGCCGGGATCATGCAGGCGGTCGACGAAATGGACTGGT
CGCCCTACGCCGGGCGCGTGGTGCTGCTGGTCACCGACGCCGGCGCGCTGCGCAAGAACGACCCGCTCGG
GCGCACCCAGATGAACGAGGCCGAGGTCCGCCAGGCGGCGCTGCGCAAGGGCGTGAAGATCTATGCCCTG
CACCTGCGCACCCCGGCCGGGAAGAACAACCACGGCTACGCCGAGCAGCAGTACCGCAGCCTCACCGCCG
ACGCCAACCCGAAGATCGCCGACCTCTACATCCCGGTGGCCGGCGGCGAGGTGAACGCCTTCGGCAACAC
GGTGAAGGAGATCGGCACGGTGTTCGCCGACCTAGTCCACGACGCCGGCAACCGCAAGCCGCAGGCGCCG
CGCTTCGACGCCGCGCCAAGCGTGGCGAGCAAGTCGGCGGCCATCGGCTACGCCATGCAGATGGAATTCC
TCGGTCGCCGCGACCCGGTGCGCGCGCCGCAGGTCGTCACCGCCTGGACCGCCGACCGTGACCTGACCAA
CCCGGCGCTGCCGGCGTTCCAGGTCTGCGTGCTGCTGAGCAAGCTGCAACTCAACGAACTGCAACAGTCG
CTGAAACTGATCGTCGACGCGGCCAAGCGCACCCAGACCTCGCCCAAGGACTTCTTCCAGGAAATCGCCA
GCGCCAGCGCCTACATGAGCCGCGACCCGGCGCAACTGGTGAAGGGCAGCAACCTGGCGCAGAGCGGCGT
GCTCGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTCTGGCTG
TCGCTGAGCGTCGCCGAACAGCAGGACTTCATCGACGAACTGGAGTCGAAGATCCGCCTCTACGAAACCT
TCCACAACGACGTCGCCAACTGGGTCCGGTTCGGCGACGCCGACGCCGGCGACGCGCTGTACCGCGTGCC
GCTGTCGACGCTGCCATGA