SecReT6
Protein ID: 218888820
SecReT6 ID324
T6SS typei3
Gene symbol-
Locus tagPLES_00761
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]89193..89921 [-]
Productputative phosphoprotein phosphatase
NotePppA
UniProt IDB7V0W1
KEGG IDpag:PLES_00761
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 6.40E-14, Aligned region: 20..209
PP2C [PF00481], Evalue: 1.70E-11, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 7.50E-08, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|218888820|ref|YP_002437684.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPEAGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNALISEEEARHHPRANVVTRAVGVHEQLELSEATLHVLPGDSFLLCSDGLNKTADDSELRDVLS
HSDPYAVVRSLVHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c89921-89193 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGGTCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAAGACGCCAGTCTCGACGCCCCCGAGGCGGGACTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGATACCCTGCGGCGTATCCCGGCGGCCTCCTCGCTACCG
GCCTATGTCGGCGCGTTGCGCACCGGCCTCGCCCAGGTCAACGAGCGGGTTCGCCAGGAGGCCGGCCTGC
GTGGCGTCAGCGTGATGGGCAGCACCCTGGTACTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAGCTGCTCGACAACGCATTGATCAGCGAGGAAGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCAACTGGAACTGTCGGAAGCCACGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCAGC
CACAGCGATCCCTATGCGGTGGTCCGCAGCCTGGTCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA