SecReT6
Protein ID: 218888823
SecReT6 ID324
T6SS typei3
Gene symbol-
Locus tagPLES_00791
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]94135..95484 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7V0W4
KEGG IDpag:PLES_00791
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 2.00E-15, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0071, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0071, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0071, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0071, Aligned region: 397..435
Protein Sequence: 449 a.a.     [Download]
>gi|218888823|ref|YP_002437687.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSGRGDGLNPLEQ
AAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWG
STSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEAL
RERTAAVIRSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFK
RIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVASNANAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c95484-94135 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCCTCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGCGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGTCCCGGCGGCCGCGCCCCGGAACCGGCCGGCGGCCCCCGCGGCGGCGATCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCGCCGCTGAGCGGCCGCGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCACTGCTGGCGATGCTCACCCGCCTGCGCAACACCATCGCCCATCCGGCGCCGGCCAGCC
TGCGCGCGCAACTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCACGCCAGGCCGGCGTGGCGCCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCGTGGGGC
AGCACCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGTTGCTCGAACACTGCCTGCAGAACCCGCACCAGCGCCTGCACCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAACTGGAGGCGCTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAGTACGAGCACGAACTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGTATCGCCATCGGCCT
GGCCTTGCTGCTGGCCTTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAAG
CGCATCCACGCCATCGGCGAGATCCCGGTGCAGGCCATCGACCGCCCGGCGGTGCAGCCGCGGGTGATCG
AGCGGCCACGCCTGGCGCGCTTCCTCGCCGACGACATCAAGGCCCAGCGAGTGGCGGTGGAGGACGCCGT
CGACCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGCGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGACGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGAGCAACGCCAACGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGCGCGCAATGA