SecReT6
Protein ID: 218888829
SecReT6 ID324
T6SS typei3
Gene symbol-
Locus tagPLES_00851
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]100859..102355 [+]
Producthypothetical protein
NoteTssC
UniProt IDB7V0X1
KEGG IDpag:PLES_00851
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|218888829|ref|YP_002437693.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|218888746|ref|NC_011770.1|:100859-102355 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGTGAGTTCGCCA
GCCTGCTGCTGCAGGAGTTCAAGCCCAAGACCGAGCGCGCCCGCGAAGCGGTGGAGACCGCCGTGCGGAC
CCTCGCCGAGCATGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGATCGACGCCAAGCTCACCGCGCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAAC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
CGTGCTGAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTATGGCTGCCTGG
TCGGCGACTACTACTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCCATGCACGCGCCGTTCATTTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAACTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGGGCGAAGAC
CGATCCGGTGGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCTCTACGGCTGGTGCTCGCGGATCC
GCGGCGTCGAGTCCGGCGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATTTCCGACCGCCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCCACCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCCCATTACCTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCCCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAAGTGGTGGTGGAGGAAGTCGAAGGCAATCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACGGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA