SecReT6
Protein ID: 218891654
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29321
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3222675..3225224 [-]
Productputative ClpA/B-type protease
NoteTssH
UniProt IDB7V8V1
KEGG IDpag:PLES_29321
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-38, Aligned region: 220..296
AAA_2 [PF07724], Evalue: 6.10E-38, Aligned region: 611..775
AAA [PF00004], Evalue: 1.50E-21, Aligned region: 220..350
AAA [PF00004], Evalue: 1.50E-21, Aligned region: 463..519
AAA [PF00004], Evalue: 1.50E-21, Aligned region: 617..734
AAA_5 [PF07728], Evalue: 4.40E-15, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 4.40E-15, Aligned region: 296..350
AAA_5 [PF07728], Evalue: 4.40E-15, Aligned region: 616..735
Clp_N [PF02861], Evalue: 6.40E-12, Aligned region: 21..71
Clp_N [PF02861], Evalue: 6.40E-12, Aligned region: 100..125
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 220..301
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 336..392
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 615..720
AAA_16 [PF13191], Evalue: 9.00E-09, Aligned region: 80..80
AAA_16 [PF13191], Evalue: 9.00E-09, Aligned region: 197..240
AAA_16 [PF13191], Evalue: 9.00E-09, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 9.00E-09, Aligned region: 605..657
AAA_19 [PF13245], Evalue: 3.60E-07, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 3.60E-07, Aligned region: 613..638
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 220..301
AAA_14 [PF13173], Evalue: 2.80E-06, Aligned region: 615..706
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 220..261
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 513..516
AAA_17 [PF13207], Evalue: 4.10E-06, Aligned region: 615..653
Zeta_toxin [PF06414], Evalue: 6.20E-06, Aligned region: 220..240
Zeta_toxin [PF06414], Evalue: 6.20E-06, Aligned region: 610..656
ClpB_D2-small [PF10431], Evalue: 6.40E-06, Aligned region: 781..848
Sigma54_activat [PF00158], Evalue: 8.80E-06, Aligned region: 243..262
Sigma54_activat [PF00158], Evalue: 8.80E-06, Aligned region: 615..733
AAA_18 [PF13238], Evalue: 3.90E-05, Aligned region: 220..240
AAA_18 [PF13238], Evalue: 3.90E-05, Aligned region: 617..651
IstB_IS21 [PF01695], Evalue: 8.00E-05, Aligned region: 214..239
IstB_IS21 [PF01695], Evalue: 8.00E-05, Aligned region: 616..636
T2SE [PF00437], Evalue: 0.00012, Aligned region: 209..236
T2SE [PF00437], Evalue: 0.00012, Aligned region: 591..685
AAA_28 [PF13521], Evalue: 0.00028, Aligned region: 220..268
AAA_28 [PF13521], Evalue: 0.00028, Aligned region: 434..451
AAA_28 [PF13521], Evalue: 0.00028, Aligned region: 616..636
AAA_25 [PF13481], Evalue: 0.00034, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 0.00034, Aligned region: 274..317
AAA_25 [PF13481], Evalue: 0.00034, Aligned region: 474..501
AAA_25 [PF13481], Evalue: 0.00034, Aligned region: 613..641
AAA_25 [PF13481], Evalue: 0.00034, Aligned region: 787..804
NACHT [PF05729], Evalue: 0.0004, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.0004, Aligned region: 616..641
ResIII [PF04851], Evalue: 0.00078, Aligned region: 206..241
ResIII [PF04851], Evalue: 0.00078, Aligned region: 288..301
ResIII [PF04851], Evalue: 0.00078, Aligned region: 592..638
FtsK_SpoIIIE [PF01580], Evalue: 0.00092, Aligned region: 201..261
FtsK_SpoIIIE [PF01580], Evalue: 0.00092, Aligned region: 443..531
FtsK_SpoIIIE [PF01580], Evalue: 0.00092, Aligned region: 617..635
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 221..241
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 617..638
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 210..236
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 613..641
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 220..237
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 452..479
AAA_23 [PF13476], Evalue: 0.0032, Aligned region: 614..642
Protein Sequence: 849 a.a.     [Download]
>gi|218891654|ref|YP_002440521.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MELAALIGRLNPDCRRALERAAQRCLQRTHHYVEIEHLLLELLDIDGGDFACLLPRFGLERDALVAEINL
SLELFKAGNTRTPALSAHTIGLLEDAVVHASVLGQAQIRSGLLLLALLDREERRALLLNSASSLLRIPHE
ALQANLLEWIQASREQPAAPNRPAAGGDKPESAQDPLLDQYTQDLTAEARAGRIDPIVGRDGEIRQCVDI
LLRRRQNNPILVGAPGVGKTAVVEGLALRIAAGEVPPSLQEVILRVLDLGLLQAGASMKGEFEQRLKGVI
DAVRNSAQPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALTRRF
QLVQVEEPDEATAVEMLRGVAGKLELHHGVQIMDAAIVDAVKLSHRYISGRQLPDKAISVLDTACARVAL
GQHDVPPPLESLRHREQALEEELQRLRREQATGLDHSARISALESESGDNRRTIRELETRWDEEREAVRE
LLDTRRELLALSESADAAKPDEELDGRIDHLAAELARLAAGLEAIRQDDPLVPEQVDSRTVAAVIAGWTG
IPVGKMLADEAHAIRSLAQRMGQRVMGQEAALGAIAQRIQAYRAGLSDPAKPVGVFLLSGPTGVGKTETA
YALADALYGGERNLISINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPD
VLEAFYNVFDKGVMEDGTGLVVDFRNTVILATSNVGAELLLDSPAEQVATPAFDERLRKVLLQTFRPAFL
ARMTVVPYRPLEEATLEGIVVAKLEKLRERYKAATGKQFDFDPAIVKAVLAKCSAAGARDIENVLMAQVT
GKLAEWVLE
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c3225224-3222675 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGAACTCGCCGCCCTGATCGGCCGCCTCAACCCGGACTGTCGCCGCGCCCTGGAGCGCGCCGCGCAAC
GCTGCCTGCAACGCACCCATCATTACGTAGAGATCGAGCACCTGCTGCTGGAACTGCTGGACATCGACGG
CGGCGACTTCGCCTGCCTGCTGCCGCGCTTCGGCCTGGAGCGCGACGCCCTGGTCGCCGAGATCAACCTG
TCGCTGGAGCTGTTCAAGGCCGGCAATACCCGCACTCCGGCGCTGTCCGCGCACACCATCGGCCTGCTCG
AAGACGCCGTGGTCCACGCCAGCGTGCTCGGCCAGGCGCAGATTCGTTCCGGCCTGCTGCTGCTCGCCCT
GCTCGACCGCGAGGAGCGCCGCGCCCTGCTGCTGAACAGCGCGTCGTCGCTGCTGCGGATTCCCCACGAG
GCCTTGCAGGCCAACCTGCTGGAGTGGATCCAGGCCTCCCGCGAACAGCCGGCCGCGCCGAACCGCCCGG
CGGCAGGCGGCGACAAGCCGGAAAGCGCCCAGGACCCGCTGCTCGACCAGTACACCCAGGACCTCACCGC
CGAAGCCCGCGCCGGGCGCATCGACCCCATAGTCGGGCGCGACGGGGAGATCCGCCAGTGCGTCGACATC
CTCCTGCGCCGGCGGCAGAACAACCCGATCCTGGTCGGCGCGCCGGGCGTCGGCAAGACCGCTGTGGTCG
AGGGCCTGGCCCTGCGCATCGCCGCCGGCGAGGTGCCGCCGTCGTTGCAGGAGGTGATCCTGCGGGTGCT
CGACCTCGGCCTGTTGCAGGCCGGCGCTAGCATGAAGGGCGAGTTCGAGCAGCGCCTCAAGGGCGTGATC
GACGCCGTGCGCAACAGCGCGCAGCCGATCATCCTGTTCATCGACGAGGCGCACACGCTGATCGGCGCCG
GCGGCGCGGAAGGCGGCAGCGACGCCGCCAACCTGCTCAAGCCGGCCCTGGCGCGCGGCGAGTTGCGCAC
CCTGGCGGCCACCACCTGGCTGGAATACAAGAAATACTTCGAGAAGGACCCGGCGCTGACCCGGCGCTTC
CAGTTGGTCCAGGTCGAGGAGCCGGACGAGGCCACCGCCGTGGAGATGCTGCGCGGCGTCGCCGGCAAGC
TGGAACTGCATCACGGCGTGCAGATCATGGACGCGGCCATCGTCGATGCGGTGAAGCTGTCGCATCGCTA
CATCTCCGGCCGCCAGTTGCCGGACAAGGCGATCAGCGTGCTCGACACCGCCTGCGCGCGGGTCGCCCTC
GGCCAGCACGACGTGCCGCCGCCGCTGGAAAGCCTGCGCCACCGCGAGCAGGCGCTGGAAGAGGAATTGC
AGCGGCTGCGCCGGGAACAGGCCACCGGCCTCGACCACAGCGCGCGTATCAGCGCCCTGGAAAGCGAGTC
GGGCGATAACCGCCGGACCATCCGCGAACTGGAGACCCGCTGGGACGAGGAACGCGAAGCGGTGCGCGAA
CTGCTCGACACCCGCCGCGAATTGCTGGCCCTCAGCGAAAGCGCCGACGCGGCCAAGCCCGACGAGGAAC
TGGACGGTCGCATCGACCACCTGGCCGCCGAACTGGCGCGCCTGGCGGCCGGCCTCGAAGCCATCCGCCA
GGACGACCCGCTGGTTCCCGAGCAGGTGGACTCGCGTACCGTGGCCGCGGTGATCGCCGGCTGGACCGGC
ATCCCGGTGGGCAAGATGCTCGCCGACGAAGCCCACGCCATCCGCTCCCTGGCCCAGCGCATGGGCCAGC
GGGTGATGGGCCAGGAGGCCGCCCTGGGCGCCATCGCCCAGCGCATCCAGGCCTATCGCGCCGGACTCAG
CGACCCGGCCAAGCCGGTCGGCGTATTCCTCCTCTCCGGCCCCACCGGCGTTGGCAAGACCGAGACCGCC
TACGCCCTGGCCGACGCCCTCTACGGCGGCGAACGCAACCTGATCAGCATCAACCTCTCCGAGTACCAGG
AAGCCCACACCGTCAGCCAGCTCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCAGCGGCGGCGTGCT
CACCGAAGCGGTGCGCCGCAAGCCCTATTCGGTGGTGCTGCTGGACGAGATCGAGAAAGCCCATCCGGAC
GTGCTGGAAGCCTTCTACAACGTGTTCGACAAGGGCGTGATGGAAGACGGCACCGGCCTGGTGGTGGACT
TCAGGAACACCGTGATCCTCGCCACCAGCAACGTCGGCGCCGAACTGCTGCTGGACAGCCCGGCCGAACA
GGTCGCCACCCCGGCCTTCGACGAGCGCCTGCGCAAAGTCCTGCTGCAAACCTTCCGCCCGGCGTTCCTC
GCGCGCATGACCGTGGTGCCTTACCGGCCGCTGGAGGAAGCCACCCTGGAAGGCATCGTCGTGGCCAAGC
TGGAAAAACTGCGGGAACGCTACAAGGCCGCTACCGGCAAACAGTTCGACTTCGACCCGGCCATCGTCAA
GGCCGTGCTCGCCAAGTGCAGCGCGGCGGGCGCGCGGGATATCGAGAACGTGCTGATGGCGCAGGTGACG
GGGAAGTTGGCGGAGTGGGTACTCGAATGA