SecReT6
Protein ID: 218891656
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29341
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3226206..3227999 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7V8V3
KEGG IDpag:PLES_29341
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-181, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|218891656|ref|YP_002440523.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGSLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEANLLGGEEAQALTGVGAARSALRLSLRCLGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
TVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVLAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGPRALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c3227999-3226206 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTACGGCACGCCG
GCGGCGCCTTCGCCGAGCGCTATCCGAAGGTCGCCCGGCGCCTGCAACTGGCTCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGTCTGCTGGAAGGTTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCAGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAACCGGACCCGACCCAGGGCAGCCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGTGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACCCTG
TGGCCGCTGGCGATCGACGAGGCGAACCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGGCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCCTGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
ACCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCACTGTCCGGCGCGCTCGCCGACGGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACCTCTTTCCGCGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTGGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTGGCCGGGAGCACCGTGCAGCCAGTCCTGGCCTACTATGGCTGCCGCCACGACAGCCACCTCG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGACCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTACGCGAAGCCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCGCGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAGTCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTGTCGCTGGTGGAAGGCCCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTCGCCCTGCACAACCTGCGCGACGACGCCAGCGCCCGCCGGCAGATAGAAGGGCTGAGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
AATCCGCCTGCGACTCGATCCGCAACACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGTTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA