SecReT6
Protein ID: 218891657
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29351
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3227983..3228408 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7V8V4
KEGG IDpag:PLES_29351
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.50E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|218891657|ref|YP_002440524.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSGALPPLFERLSAEADERPAFDDQALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c3228408-3227983 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCAGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCAGCGGTCGAGCATTTCGAGCCGCGTCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGTAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA