SecReT6
Protein ID: 218891659
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29371
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3228992..3230476 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7V8V6
KEGG IDpag:PLES_29371
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-190, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|218891659|ref|YP_002440526.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDKDTVAMINDRI
SQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLTKIFESLELIKWRAFRESEDSRYVSLVLPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAA
WVLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISL
CHKKNSDVAVFFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c3230476-3228992 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCCCAAGTCATCCGCCGCCGAACAATCCGGCGAGAGTTCGACCCAGACCCTGTCCCTGCTCGACGAGA
TCATCGCAAAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTATGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTCCTCGACGAGGGCATGGCCGTCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGATGCGCTGATCAGCGACCAGCTCAACCAGATCATCCACCACCCCGAGTTGCAGAAGCTGG
AAGCCTCCTGGCGCGGCCTGCACCAACTGGTGAGCAACACCGAGACCAGCGCGCGGCTCAAGCTGCGCCT
GCTGAACGTCGGCAAGAACGAACTGCAGAACGACCTGGAGAAGGCGGTCGAGTTCGACCAGAGCGCACTG
TTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGACACCCCTTCAGCCTGCTGATCGGCGACT
TCACCTTCGGTCGCCATCCGCAGGACATCGGCCTGCTGGAGAAGCTGTCGAACGTCGCCGCGGCTGCCCA
CGCGCCGTTCATCGCCGCCGCCAGCCCACGCCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTACCG
CGCGACCTGACCAAGATCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGATT
CGCGCTACGTGTCCCTGGTGCTGCCGAACTTCCTCCTGCGCCTGCCCTACGGCCCGGAGACGCGCCCGGT
GGAAGGCATGAACTATGTCGAGGACGTCAACGGCACCGACCACTCCAAGTACCTCTGGGGCAACGCCGCC
TGGGTCCTGGCGCAGCGCATCACCGAGGCCTTCGCCAAGTACGGCTGGTGCGCGGCGATCCGCGGCGCGG
AAGGCGGCGGCGCGGTCGAGGGCCTGCCAGCGCACACGTTCCGCACCAGCTCCGGCGACCTGTCGCTGAA
ATGCCCGACCGAAGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGATCTCGGCTTCATTTCCCTG
TGCCACAAGAAGAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAGGCTCTACA
ACACCAACGAGGCCAACGCCAACGCGCGCCTGTCGGCGATGCTGCCGTACGTGCTGGCGGCATCGCGCTT
CGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTGAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCACCGCAGGAAATCAAGGCGCAGT
ACCCGCTGCGCGAGGCGCGGGTGGATGTCAGCGAGGTGGCCGGCAAACCGGGGGCCTACCGCGCCACGGT
GTTCCTCCGGCCGCACTTCCAGCTCGAGGAACTCAGCGCGTCGATCCGCCTGGTCGCCAACCTGCCGCCG
CCGGTAGCGGCGTGA