SecReT6
Protein ID: 218891662
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29401
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3231789..3233120 [+]
Producthypothetical protein
NoteTssK
UniProt IDB7V8V9
KEGG IDpag:PLES_29401
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-69, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|218891662|ref|YP_002440529.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKA
LFLGGRLRLAQQAGNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|218888746|ref|NC_011770.1|:3231789-3233120 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGACAGGCCTGCAACCCTTGGTTCTGGGGAGTGAC
CGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCAAGTGCGGGTCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGACGCGCCGCTGGAGTTCGATCTGGAGACAGCGC
TGGCGGCCGCCGAAGGGCCGTTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTATGTCAGCCTGCCCTACGTCCCGCCGACGCC
ACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCGGGCAACCAGGACGACGCGGTGGAAATCCGTC
GCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCGAAGGCCTGCTGGCAAGCCGTGCGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGTTGGAGC
GGGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTATTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGACCCGCACCTGCCGTTGCTCGCCCGGC
AACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTTGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG