SecReT6
Protein ID: 218891666
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29441
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3238915..3240000 [+]
Productputative transcriptional regulator
NoteSfa3
UniProt IDB7V8W3
KEGG IDpag:PLES_29441
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 8.40E-69, Aligned region: 22..188
Sigma54_activat [PF00158], Evalue: 8.40E-69, Aligned region: 300..308
Sigma54_activ_2 [PF14532], Evalue: 1.10E-21, Aligned region: 26..192
AAA_5 [PF07728], Evalue: 5.20E-09, Aligned region: 46..162
AAA_5 [PF07728], Evalue: 5.20E-09, Aligned region: 262..302
Mg_chelatase [PF01078], Evalue: 0.00017, Aligned region: 42..65
Mg_chelatase [PF01078], Evalue: 0.00017, Aligned region: 100..163
AAA [PF00004], Evalue: 0.00054, Aligned region: 46..162
HTH_30 [PF13556], Evalue: 0.0014, Aligned region: 315..347
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 243..259
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 308..343
AAA_16 [PF13191], Evalue: 0.0026, Aligned region: 35..83
AAA_16 [PF13191], Evalue: 0.0026, Aligned region: 280..298
AAA_2 [PF07724], Evalue: 0.008, Aligned region: 42..141
Protein Sequence: 361 a.a.     [Download]
>gi|218891666|ref|YP_002440533.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSVITHPHARELTKSVRATVLVFNDPRSRELLERIERLAPSEANALVIGETGTGKELVARHIHALSGRNG
GPFVAVNCGAFAESLVESELFGHEKGAFTGALQSKAGWFEAANGGTLFLDEIGDLPPSIQVKLLRVLQER
EVVRLGSRRPIPIDVRLVAATNVDLADAVVAGHFREDLFYRLHVATIQLPPLRERRGDILPLAEYFIVEH
CRRLGYTSASLSPEAERKLLGHSWAGNIRELENAIHHALLVCRNRLIQPADLHLIDMRARQEPSGLRRAP
ESAAGSALEAALQALFEENREDLYEHIEETVFRAAYRFCHGNQLQTGRLLGISRNIVRARLEKIGELETS
PRHNVVSLVGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|218888746|ref|NC_011770.1|:3238915-3240000 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGTCCGTCATCACCCATCCCCACGCCCGCGAGCTGACCAAATCGGTGCGCGCCACCGTGCTGGTGTTCA
ACGACCCCCGTTCCCGCGAGCTGCTGGAGCGCATCGAGCGCCTGGCGCCCAGCGAGGCCAACGCGCTGGT
CATCGGCGAGACCGGCACCGGCAAGGAGCTGGTGGCGCGCCATATCCACGCCCTCAGCGGACGCAACGGC
GGCCCGTTCGTCGCGGTCAACTGCGGTGCTTTCGCCGAGAGCCTGGTGGAGAGCGAGCTGTTCGGTCACG
AGAAGGGCGCCTTTACCGGTGCGTTGCAGAGCAAGGCCGGCTGGTTCGAGGCAGCCAACGGCGGCACCCT
GTTCCTCGACGAGATCGGCGACCTGCCGCCGAGCATCCAGGTCAAGCTGCTGCGCGTGCTGCAGGAACGC
GAGGTGGTGCGGCTCGGTTCGCGCCGGCCGATCCCCATCGACGTGCGGCTGGTGGCGGCGACCAACGTCG
ACCTGGCTGACGCGGTGGTCGCCGGACACTTCCGCGAGGACCTGTTCTACCGCCTGCACGTGGCGACCAT
CCAACTGCCGCCGTTGCGCGAGCGCCGCGGCGATATCCTGCCGCTGGCCGAGTACTTCATCGTCGAGCAC
TGCCGGCGCCTCGGCTACACCAGCGCGAGCCTGAGCCCGGAAGCCGAGCGCAAGCTGCTCGGGCATTCCT
GGGCGGGCAATATCCGCGAGCTGGAGAACGCCATCCACCACGCGCTGCTGGTCTGCCGCAACCGCCTGAT
CCAGCCGGCCGACCTGCACCTCATCGACATGCGTGCGCGCCAGGAGCCGAGCGGCTTGCGCCGCGCCCCC
GAGAGCGCCGCCGGCTCGGCGCTGGAAGCGGCGCTGCAGGCACTGTTCGAGGAAAACCGCGAGGATCTCT
ACGAGCACATCGAGGAAACCGTGTTCCGCGCCGCCTATCGCTTCTGCCACGGCAACCAGTTGCAGACCGG
ACGCCTGCTGGGGATCAGCCGCAACATCGTGCGCGCCCGCCTGGAGAAGATCGGCGAGCTGGAAACCTCG
CCACGACACAACGTGGTCTCGCTGGTGGGCAAGTGA