SecReT6
Protein ID: 218892377
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36591
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4049129..4049998 [-]
Productputative outer membrane protein
NoteTssL
UniProt IDB7UV53
KEGG IDpag:PLES_36591
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-69, Aligned region: 61..266
Protein Sequence: 289 a.a.     [Download]
>gi|218892377|ref|YP_002441244.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSLNPLVAAASEL
LSEVVRLKHSTVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNESEW
SKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALY
RQIRQLRGDVPRELSPHWQGLSDQRRGLVRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSL
DAAAGQPGS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4049998-4049129 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGATCAAGGAAAGGGAATACCACGAGGACGAGAAGACCGTCCTCCTCGATCACCAGGGACAGGTACCGG
CCCAGGGGCCGCTGACCGATTTCGCCGAACCGCCGCGCTTCGAGCAGCTCGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGTCCGGGCGAGGCCTTCAACGTCAGCCTGAACCCGCTGGTGGCGGCGGCTTCCGAACTG
CTTTCGGAAGTGGTCCGGCTCAAGCACAGCACCGTGCTGGAGAACCTTGCGGCGCTCAAGGAGCGGTTGA
CCTCCGCCATGAAGCTCTTCGAATTCCGCGCCGTGCAGGATGGCGTGGAAAACAGCCAGGTCATGGCGGC
GCGCTACGTGCTGTGCACGGTGGTCGACGAGGCGGTGGTGACCACCCCGTGGGGCAACGAAAGCGAATGG
TCGAAGATCAGCCTGCTGAGCAGCTTCCATAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGTTGCTCG
ACCGGCTGTCGAAGAACCCGGTCAAGCACCTGCCGATGCTGGAGCTGATGTACCTCTGCCTGGCCCTCGG
CTTCGAGGGCAAGTACCGGGTGATGGCTCGCGGCGTGCTCGACCTGGACGGTATTTCCGATGCGCTCTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCGCGCGAACTGTCGCCGCACTGGCAGGGGCTCAGCGACC
AGCGTCGCGGCCTGGTGCGGATCGTGCCCTGGTGGATGGTGGCGCTGTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGATTCGCCTGGGTTCTCGGCGAACAACGCGACACGGTGCTGCAGCCTTACCAGTCGCTC
GATGCGGCGGCAGGACAGCCCGGTTCGTAA