SecReT6
Protein ID: 218892384
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36661
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4057443..4058450 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7UV60
KEGG IDpag:PLES_36661
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.10E-89, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|218892384|ref|YP_002441251.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLRQEHPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGASSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELVAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4058450-4057443 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCCAGGAACATCCCGGCCTGGGAGACGAGGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGCTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGCGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAGTT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCTCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTGTTGCCGATCTGGCGCAAGTACCGCTACCGGGTG
AGCTTCCAGAGCGGCGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAGGCCAGGGAACTGAACTGGAAACGCCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGGTCGCCGAGCAG
TGTATCGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGGCTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTTCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATCCGGCTGGTCTTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACGCCTGCCGCCTTGGCTGGACCAGCTGGCTGGGCCGGGAGCGCGCGGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA