SecReT6
Protein ID: 218892385
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36671
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4058414..4059994 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7UV61
KEGG IDpag:PLES_36671
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.10E-148, Aligned region: 1..526
Protein Sequence: 526 a.a.     [Download]
>gi|218892385|ref|YP_002441252.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYS
VTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRALDGVAG
KPMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVR
GLELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGV
TGWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTC
TNQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVIL
ETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNE
FFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4059994-4058414 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCC
TGACCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGT
CGCCTGTCGCTTCCGTACCTGCTACGCCACCGAAGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCG
GTGACCGGCGAGGGTGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCATCTCGGCGAGCTGG
GCCTGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCT
GCGCAACCTGGAGAGCATCCAGCTGATTCCGCTAGACGCCCATGGGCGGGCGCTGGATGGCGTGGCCGGC
AAGCCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGGTTCGCCGAAGACGAGGCGTTGA
TTCCCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAATACTTCGCGTTCCAGGACAAGTT
CCTGTTCGTCGACGTGGATGGCCTTGACCTGCTCGGCGCTCTGCCCGAGGAAACCCTCAAGCAGGTCCGC
GGCCTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCA
AGCTGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCA
GGACGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAGGGCGTC
ACCGGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCCTATGTGCCGTTCGAGTCCTTCGAGCACGATCCCA
GCTTCGACGTCCCGGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCT
GGACACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGC
ACCAACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCTTGCGAAGGTACGCCGGAGT
TCCTCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTG
GAAACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCACTCAAGGTGATCCTC
GAAACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGC
TCAAGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGA
GCTGACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAA
TTTTTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGT
ACCAATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA