SecReT6
Protein ID: 218892386
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36681
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4060539..4060946 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7UV62
KEGG IDpag:PLES_36681
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 24..112
Protein Sequence: 135 a.a.     [Download]
>gi|218892386|ref|YP_002441253.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSDVRVVSLPRDNDQLRLAFSIEGLLEVGGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4060946-4060539 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACTGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCGACGTGCGTGTCGTTTCCC
TGCCACGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGCTTGCTGGAGGTGGGAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA