SecReT6
Protein ID: 218892388
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36701
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4062463..4062969 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7UV64
KEGG IDpag:PLES_36701
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.70E-54, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|218892388|ref|YP_002441255.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRTDERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4062969-4062463 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACCTTCAAGCCCGCCACTGGCGGTG
CCCAGGAAGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCACGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGTTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA