SecReT6
Protein ID: 218892389
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36711
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4063005..4064561 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7UV65
KEGG IDpag:PLES_36711
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|218892389|ref|YP_002441256.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTYSSKLSSHYLELAEQPISKDVFAGEDVRFSSEYEALENELGKALSLHENGQTDWLKILENSEALLRAQ
SKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRAAAIAWLVPRLEQALNENVPI
KEQLPLFRRLAEHLEKLDTALTAQLGDDAPLLLPISRRLSGMLQRAADNQPEPGVVGAVVAQVKQAASQL
LAPGAPIDNERDAHKAMRAQQEAARPLCAWWLKQKATDLRALRLNRTMLWLPIESMPERNAEQVTALRGV
PADKLKSYQERFAQGLYADLLVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPG
LVELRFHDGSAFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDVLHLLHSCCEL
LPQNHAVRERKEDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4064561-4063005 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACCTATTCGAGCAAGCTCTCCTCGCATTATCTGGAACTCGCGGAACAGCCGATTTCAAAGGATGTCT
TTGCGGGTGAGGATGTGCGTTTTTCCAGCGAATACGAGGCGCTGGAAAATGAGCTGGGCAAGGCGCTCTC
GCTCCATGAGAACGGCCAGACCGACTGGTTGAAAATCCTGGAAAACAGCGAAGCGCTGCTTCGTGCCCAA
TCCAAGGACCTGCGTGTTGCAGCCTGGTTGACCTGGGCCCTCTACCAACGGGAATCCTTTCCCGGTTTGC
TGGCCGGACTGGGATTGCTGGAACGTCTGTGCAGCCGGCATTGGGTCGAGATCCATCCGCTCAAGGCGCG
CACTCGCGCCGCGGCCATTGCCTGGCTGGTGCCCCGGCTGGAGCAGGCGCTGAACGAGAACGTACCGATC
AAGGAGCAACTCCCCCTGTTCCGGCGTCTCGCCGAGCACCTGGAAAAACTCGATACCGCGCTGACCGCGC
AACTGGGCGACGACGCGCCCTTGTTGCTGCCGATCAGCCGACGCCTTTCGGGCATGCTCCAGCGCGCCGC
CGACAACCAGCCCGAACCTGGCGTGGTCGGCGCCGTGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCGCCGGGTGCGCCCATCGACAACGAGCGCGACGCCCACAAGGCCATGCGCGCCCAGCAGGAGGCCG
CACGCCCCCTGTGCGCCTGGTGGCTGAAGCAGAAAGCCACCGATCTGCGCGCGCTGCGCCTCAACCGAAC
GATGCTCTGGCTGCCCATCGAGTCCATGCCCGAGCGCAATGCCGAACAGGTCACCGCGCTAAGGGGAGTG
CCGGCGGACAAGCTGAAAAGCTACCAGGAGCGTTTCGCCCAGGGCCTGTACGCCGATCTCCTGGTGGAGC
TGGAGGCGAGCCTGGCACGGGCGCCGTTCTGGTTCGACGGCCAGCGCCTGGTCTGGGAGTGCCTGCAAGG
GCTCAACGCCGAGCAGGCGATGCGGGAAGTCGAAATGCATTTCGCCTTGCTCCTGCAGCGTCTGCCGGGG
CTGGTGGAGCTGCGTTTCCACGATGGCAGCGCATTCGCCGATGCGGCCACCCGCGGCTGGATCAGCGCCC
ATGTCATGCCCCATCTCCAGAACGACAGTGCGCCGCGCAAGGTCGAGACCGTGGCCCTGCAGGCCGAATG
GGACGTCGCCCTGGACGAGGTCCAGCCGGTGTTGCGCAAGGACGGCCTGAAGGCGGCGGTACAGGTGTTG
AAGCAGGGCATGAAGCGCGCCCACGGCGGGCGCGCCCGGTTCTTCTGGCAACTGAGCCTCGCGCGACTGT
GCTTCCTGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGAGCCTCGACCATCAGTTGCACGAATC
GGGATTGCACGCCTGGGAGCCCGATCTGGCGCTGGATGTACTGCACCTGCTGCATAGCTGCTGCGAGCTG
TTGCCGCAGAACCACGCCGTGCGAGAACGCAAGGAAGACATTTATCGCAGGCTGTGCCACCTCGATCTCG
AGGTGGTGCTCGAATAG