SecReT6
Protein ID: 218927698
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0500
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]533725..534285 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ7CG91
KEGG IDype:YPO0500, ypk:y3675, ypm:YP_3679
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-57, Aligned region: 11..165
Protein Sequence: 186 a.a.     [Download]
>gi|218927698|ref|YP_002345573.1| hypothetical protein YPO0500 [Yersinia pestis CO92]
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDRKFLTFDQDNF
DARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGK
TSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVEDDDGEK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|16120353|ref|NC_003143.1|:533725-534285 Yersinia pestis CO92 chromosome, complete genome
ATGGCCAAAGATGCGAGCTCGCAAAAATTTATCGGTAGAAATAATGCACCTAGAGTGCAAATTGAATATG
ACGTCGAAATTTATGGTTCAAATAAGAAAGTAGAGTTGCCTTTTGTAACCGGCGTGATGGCTGATCTTTC
TGGCCACAGAGCAAAGCCTCTTCCTGCTGTTGAAGATCGTAAATTCCTTACTTTCGATCAGGATAATTTC
GATGCCCGGATGAGAGCAATTAAGCCTCGCCTTAAATTCTACGTAGATAACACCTTGAGTGAGGATAACG
AACTCCTGGATATCGAACTGGATTTTGAGTCAATGGATGACTTTTCCCCCGGATCGTTAGCGCGGCGTAT
TCCTCAAATGGAAAAACTGCTTGAGGCACGCACCCATCTGGCTGAATTGATCACCTATATGGATGGTAAA
ACCAGCGCAGAAGAGGTGGTTAAACAACTGCTTGAACAACCTGATTTTTTACAAAATCTTGCGACCGATG
CACAGGGAACTATTTCGAAGCTCAGCCAGGATGATGATGTTTTAGTGGAAGATGACGATGGAGAAAAATA
G