SecReT6
Protein ID: 218927699
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0501
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]534285..535796 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ7CG92
KEGG IDypk:y3674, ypm:YP_3678, ype:YPO0501
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-184, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|218927699|ref|YP_002345574.1| hypothetical protein YPO0501 [Yersinia pestis CO92]
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIE
SLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAW
DQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWR
ELGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFT
WANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNA
GFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRL
VSKLPSNKESEKK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|16120353|ref|NC_003143.1|:534285-535796 Yersinia pestis CO92 chromosome, complete genome
GTGGAGAACATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGT
TAGATGACATTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCAT
AGGCACGCTTGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAG
TCTTTAGTCGCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCC
AAAAGCTGGAATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAA
AATACGGGTACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGG
GATCAAAGTCCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTT
GCATGATCGGTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGT
GGCCGCCGCCGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGG
GAGCTGGGTAACCCAAGGGATATCGGCAAAATCTTTACCACACCTGAATATGCGCCATGGAGACGTTTAC
GTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGC
CAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACC
TGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAA
GGATCCGCGGTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGG
CGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCT
GGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATG
CACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTT
TGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGG
GATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAG
AAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGG
TTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTG
GTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA