SecReT6
Protein ID: 218927701
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0503
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]536551..536994 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7CG94
KEGG IDypm:YP_3676, ype:YPO0503, ypk:y3672
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-14, Aligned region: 23..123
Protein Sequence: 147 a.a.     [Download]
>gi|218927701|ref|YP_002345576.1| hypothetical protein YPO0503 [Yersinia pestis CO92]
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNYGLPSLSQQVP
VITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYS
YGMVRVL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|16120353|ref|NC_003143.1|:536551-536994 Yersinia pestis CO92 chromosome, complete genome
ATGGATATTTCAGCACCGATACTTTTTGACAAATTAAGTCTCCGCCATGAACACGTTCGCTTACCTCATT
GGCGTGAAGTGATTGTGCGCGATATTGAATCTTTATTGAATGACTCCGCACACAGTGCCCGGTTGAAGCT
AAAAAAGTATCCGCATTGTGAGGCTTCTGTATTGAATTACGGGCTGCCTTCGCTCAGTCAGCAGGTACCG
GTAATCACCGACTTGCTGGAACTGGCCAGACATATACAGCGGATCATCGCCACGTTTGAGTCACGCCTGG
ATCCGCGCTCAATAAAAGTGGTGCCGCTGATTAATAAAGGCGAAACCTGGGTGTTAGCCATCCTGTTTGA
CATTCATGCCCGGTGCAACCTACCGGGCGAAGAGCACTTGGTCAATTTACGCATCGCGCTCGATTACTCC
TATGGAATGGTTCGCGTTCTTTAA