SecReT6
Protein ID: 218927703
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0505
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]538864..539847 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0WJG0
KEGG IDype:YPO0505
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-66, Aligned region: 18..312
Protein Sequence: 327 a.a.     [Download]
>gi|218927703|ref|YP_002345578.1| hypothetical protein YPO0505 [Yersinia pestis CO92]
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQT
LNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHV
AVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEAR
KGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRH
RMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 984 bp     [Download]
>gi|16120353|ref|NC_003143.1|:538864-539847 Yersinia pestis CO92 chromosome, complete genome
ATGGCTAGCCTCCAGACGCTGAAAAACACGTTTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGT
TGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCT
GCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACG
CTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATG
GCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGA
ACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTC
GCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGC
CGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAG
AGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGT
AAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTA
TTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATA
TCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCAT
CGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAA
CGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTAC
CTAG