SecReT6
Protein ID: 218927710
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0511a
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]548882..549247 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.70E-20, Aligned region: 18..107
PAAR_motif [PF05488], Evalue: 0.0028, Aligned region: 66..120
Protein Sequence: 121 a.a.     [Download]
>gi|218927710|ref|YP_002345585.1| hypothetical protein YPO0511a [Yersinia pestis CO92]
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGT
HSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>gi|16120353|ref|NC_003143.1|:548882-549247 Yersinia pestis CO92 chromosome, complete genome
ATGACAGCAGCCAATACTCGCGCAGGTGGGATCAGCTTTATCGGCAGTGACCCGATGATCCCGATATCTG
CTCCCAACACCGCGCCCAACGCCAATGGTATTCCTAATGTCAGCAACTATTTTTGCTGTGGGGGTAACGA
ACAGAATCTCAACACCATCCGTCCAGCCACGATAGACGGCGGATCTGTGATGGGGGCGGCCTCGGGGACA
CATTCGGCCAAGATGGACCCTATGCAGGGATCAGGAAAGTATTTCATTCAGGGAAGCCCAGCAACACGTT
TAGGAGATATGAGTATGACCAATAATTACAACGCGCCTTCGACGCAAATTGCGCCCAGCCAGACCAAGTA
TTTTGTCAATGCGTAG