SecReT6
Protein ID: 218928143
SecReT6 ID18
T6SS typei2
Gene symbol-
Locus tagYPO0970
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1074635..1076983 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7CGQ3
KEGG IDypk:y3361, ype:YPO0970
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 3.90E-48, Aligned region: 582..598
DUF2345 [PF10106], Evalue: 3.90E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 1.80E-16, Aligned region: 393..481
Protein Sequence: 782 a.a.     [Download]
>gi|218928143|ref|YP_002346018.1| hypothetical protein YPO0970 [Yersinia pestis CO92]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAP
ETTEPTSHFTFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c1076983-1074635 Yersinia pestis CO92 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGTTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTCTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGACGAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAGGCAAATAAACCAGAAGATTTTCCGAGTGTTGCCCCG
GAAACAACAGAACCCACCAGTCATTTCACTTTTTCCTGA