SecReT6
Protein ID: 218928145
SecReT6 ID18
T6SS typei2
Gene symbol-
Locus tagYPO0973
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1080046..1080537 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ7CHN3
KEGG IDype:YPO0973, ypm:YP_3466, ype:YPO1470, ypk:y2700, ypm:YP_1361, ypk:y3363
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|218928145|ref|YP_002346020.1| hypothetical protein YPO0973 [Yersinia pestis CO92]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c1080537-1080046 Yersinia pestis CO92 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACCGATAACAATAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTATTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTTAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCTTGGAATGAGCGCGCCACCGCAT
AG