SecReT6
Protein ID: 218928147
SecReT6 ID18
T6SS typei2
Gene symbol-
Locus tagYPO0975
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1082277..1082963 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ7CHN1
KEGG IDype:YPO0975, ypk:y3366, ypm:YP_1359, ypm:YP_3464, ype:YPO1468, ypk:y2703
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|218928147|ref|YP_002346022.1| hypothetical protein YPO0975 [Yersinia pestis CO92]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c1082963-1082277 Yersinia pestis CO92 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCGGAGCCGGTGTAA