SecReT6
Protein ID: 218928149
SecReT6 ID18
T6SS typei2
Gene symbol-
Locus tagYPO0977
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1084324..1085868 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7CHM9
KEGG IDypk:y2705, ypk:y3368, ypm:YP_1357, ype:YPO0977
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 15..53
DUF877 [PF05943], Evalue: 8.50E-175, Aligned region: 92..510
Protein Sequence: 514 a.a.     [Download]
>gi|218928149|ref|YP_002346024.1| hypothetical protein YPO0977 [Yersinia pestis CO92]
MLMSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSV
FLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIE
LLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAA
HMPFIGSVGPEFFGKENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVK
IPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c1085868-1084324 Yersinia pestis CO92 chromosome, complete genome
ATGCTGATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGG
CACAAGGGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGA
GGCGTTCCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTC
TTTTTAGACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATA
TTGCCGCACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGT
GGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAG
CTGCTGGATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTT
TATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAA
CTACGAGTTCGACCGTAGCCCGCAAGATATCGCGTTATTGCGCAATATCTCCAAGGTCGCGGCGGCAGCC
CATATGCCGTTTATCGGTTCCGTTGGCCCCGAGTTCTTTGGTAAAGAGAACATGGAAGACGTGGCAGCCA
TCAAAGATATCGCCAACTACTTTGACCGTGCTGAATACATCAAGTGGAAAGCCTTCCGCGACTCGGATGA
TTCCCGCTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTACGGCCCGGACACGGTGCCG
GTACGCAGCTTCAACTACGTTGAGCAGGTGAAAGGGCCGGATCATGATCGCTACTTGTGGACCAATGCCT
CATTTGCCTTTGCTGCTAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGGGGCCC
GCAGGCCGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAA
ATTCCGTCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGT
CGTACTACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGA
CACCGCGGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATT
GCCCATTATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGG
CATAA