SecReT6
Protein ID: 218928150
SecReT6 ID18
T6SS typei2
Gene symbol-
Locus tagYPO0978
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1085911..1086411 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ0WI63
KEGG IDype:YPO0978
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|218928150|ref|YP_002346025.1| hypothetical protein YPO0978 [Yersinia pestis CO92]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c1086411-1085911 Yersinia pestis CO92 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCTCCC
TGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGCCAA
AAGAGGGTTAA