SecReT6
Protein ID: 218929988
SecReT6 ID21
T6SS typei3
Gene symbol-
Locus tagYPO2934
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]3277633..3278982 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7CJC9
KEGG IDype:YPO2934, ypk:y1549, ypm:YP_2761
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-144, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|218929988|ref|YP_002347863.1| hypothetical protein YPO2934 [Yersinia pestis CO92]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQG
PKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFI
RTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|16120353|ref|NC_003143.1|:c3278982-3277633 Yersinia pestis CO92 chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGC
GCTATCTTGAATATTACGCCCATAAGCGAGCTGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATA
TGAAATTGATAGAGAAGCACTCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGAC
GGTACACCATTTGATATTCCCGGCCATGCTGAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGG
GTAAGTTGATCTATCTGGCGGTACCACTGCGCCTGGATAACAGTGATGAAACCATTTTTGATGAGCACGA
TATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATACCAATGCCATTCGGCAAGGG
CCGAAGCCGGTACAACTGTCAAGATTACGTCTCAGATTAGTCTCAGAAGGTGAGATGACAGAATCATGGA
TTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGGAGTGTCTTGCTACACACCGAAGACTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGCTAACCCATCTTAATGGTTTG
GTTAAAATGCGCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAG
AAATTGTCGATTATTTGTTACTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCATAT
TCCTGAATTACCGCCTATTACGCTTTATCAGGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATC
CGGACCAAAACCCGCCGACCCCGCCCGGCACCTGGCTATGATCATGCGAAGCTCTATGCGTCTATTCGTC
CGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCTGGGCAGATGATACCGCTGGA
GACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTCAAATCTGGTC
CTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCGGTACC
GCCCAGACAAATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGAC
AAAGTTTCCAATGCTGGTGCCATTGCCCTGCATGTGGCGGGTGATTTCCCTGCCTTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA